Conserved Protein Domain Family
PRK14814

?
PRK14814: PRK14814 
NADH dehydrogenase subunit B; Provisional
Statistics
?
PSSM-Id: 173275
View PSSM: PRK14814
Aligned: 6 rows
Threshold Bit Score: 385.534
Threshold Setting Gi: 116330239
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24213594    1 MGLSDLSKTPGQALGDMVQLGNVESVIQWGRSYSLWPYPFATACCGIEYMSTACSDYDIARFGAERPSFSPRQADMILVL 80 
45658576    1 MGLSDLSKTPGQALGDMVQLGNVESVIQWGRSYSLWPYPFATACCGIEYMSTACSDYDIARFGAERPSFSPRQADMILVL 80 
116330239   1 MGLSDLSKAPGQALGDMLQLGNIESVIQWGRGNSLWPFPFATACCGIEYMSTACSDYDIARFGAERPSFSPRQADMILVL 80 
116329153   1 MGLSDLSKAPGQALGDMLQLGNIESVIQWGRGNSLWPFPFATACCGIEYMSTACSDYDIARFGAERPSFSPRQADMILVL 80 
189910788   1 MGLTETLSKPGEMFGDMFQVATLDNVVQWGQSFSLWPYPFATACCGIEYMSTACADYDIARFGAERPSFSPRQADMILVL 80 
183220687   1 MGLTETLSKPGEMFGDMFQVATLDNVVQWGQSFSLWPYPFATACCGIEYMSTACADYDIARFGAERPSFSPRQADMILVL 80 
24213594   81 GTITYKMAPVLRQIYDQMAEPKFVISVGACASSGGMFHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALLKLQTKLKTQ 160
45658576   81 GTITYKMAPVLRQIYDQMAEPKFVISVGACASSGGMFHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALLKLQTKLKTQ 160
116330239  81 GTITYKMAPVLRQIYDQMAEPKFVISVGACASSGGMFNTYGVLQGVDRILPVDIYVPGCPPRPEAILDALVKLQTKLKTQ 160
116329153  81 GTITYKMAPVLRQIYDQMAEPKFVISVGACASSGGMFNTYGVLQGVDRILPVDIYVPGCPPRPEAILDALVKLQTKLKTQ 160
189910788  81 GTITYKMAPVLRQIYDQLAEPKFVISVGACASSGGMFHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALVKLQKKVQSQ 160
183220687  81 GTITYKMAPVLRQIYDQLAEPKFVISVGACASSGGMFHTYGVLQGVDRILPVDVYVPGCPPRPEAILDALVKLQKKVQSQ 160
24213594  161 GLEARRQEVMQKIQELNERNKPLVVR 186
45658576  161 GLEARRQEVMQKIQELNERNKPLVVR 186
116330239 161 GLEARRQEVMQKIQELNERNKPLVVR 186
116329153 161 GLEARRQEVMQKIQELNERNKPLVVR 186
189910788 161 GLEARRQEVMRKIEEINERNKPLVVA 186
183220687 161 GLEARRQEVMRKIEEINERNKPLVVA 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap