Conserved Protein Domain Family
PRK14813

?
PRK14813: PRK14813 
NADH dehydrogenase subunit B; Provisional
Statistics
?
PSSM-Id: 173274
View PSSM: PRK14813
Aligned: 11 rows
Threshold Bit Score: 381.923
Threshold Setting Gi: 193216261
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194336921   1 MGLLDAGITQHNVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
194333676   1 MGLLDAKISNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
189500538   1 MGLLDAKISNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
193212957   1 MGLLDAKVSNRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
193216261   1 MGLLDQKFDKGGVVITAAENVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTFK 80 
189346374   1 MGLLDAGITKHNVVVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
119356790   1 MGLLDAGITKHNVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMLVAGTVSMK 80 
145219899   1 MGLLDAAVSRQNVLVTSVDSVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
21673597    1 MGLLDARISNRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTMK 80 
78186619    1 MGLLDAGFSRDNVLVAPVDAVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVSMK 80 
78188613    1 MGLLDAGITNHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMLVAGTVTMK 80 
194336921  81 MAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVDRVIPVDVFVPGCPPRPESLIGGLMKVQELIRMEQIGL 160
194333676  81 MAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWKHGYHVLKGVDRIIPVDVYVPGCPPRPEALIGGLMKVQELIRMEQIGI 160
189500538  81 MAERVIRLYEQMPEPRYVLSMGSCSNCGGPYWKHGYHVLKGVDRIIPVDVYVPGCPPRPEALIGGLMKVQELIRMEQIGI 160
193212957  81 MAERVVTLYEQMPEPRYVLSMGSCSNCGGPYWDHGYHVLKGVDRVIPVDVYVPGCPPRPEALIGGLMKIQELIRMEGLGI 160
193216261  81 MAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGLMKVQELIREEKFAG 160
189346374  81 MAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVDRVIPVDVYVPGCPPRPESLIGGLMKVQELIRMEQIGL 160
119356790  81 MAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVDRIIPVDVYVPGCPPRPESLIGGLMKVQELIRMEQIGI 160
145219899  81 MAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVDRVIPVDVYVPGCPPRPEALIGGLMKIQELIRMEGLGV 160
21673597   81 MAERVVTLYEQMPEPRYVLSMGSCSNSGGPYWHHGYHVLKGVDRIIPVDVYVPGCPPRPEALIGGLMKIQELIRMEGLGI 160
78186619   81 MAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVLKGVDRVIPVDVYVPGCPPRPEALIGGLMKVQELIRMEQIGM 160
78188613   81 MAERVIRLYEQMPEPRYVLSMGSCSNSGGPYWEHGYHVLKGVDRIIPVDVYVPGCPPRPESLIGGLMKVQELIRMEQIGL 160
194336921 161 SRADALKKLAEKSVDPQFVIERERKAAGA 189
194333676 161 SRAEALKKLEEKSFDPGIVLEHQRKSQAV 189
189500538 161 SRVEALKKLEEKNIDPGQLIEDARKGAMA 189
193212957 161 SREEALKKLAEKSVDAQQVLDQTRKAAIA 189
193216261 161 DRREAIERLKPKKVKAEDVIVETSASAKK 189
189346374 161 SRADALKKLAEKSIDPQSVIEQHRQVARA 189
119356790 161 SRADALKKLAEKSVDPRVVIEEERKALRA 189
145219899 161 SRADALKKLAEAESDPQPLIEEARKQKTA 189
21673597  161 SRQDALKKLAGKRVDPQQVIDQVRKSATA 189
78186619  161 SRQEALKKLAETGVEPRPFIERERSSAGA 189
78188613  161 SRADALKKLAENPIDPQAIIEQQRKTAVA 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap