Conserved Protein Domain Family
PRK14812

?
PRK14812: PRK14812 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173273
View PSSM: PRK14812
Aligned: 12 rows
Threshold Bit Score: 232.689
Threshold Setting Gi: 194397849
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15901116    1 MAGSSREYAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
15903176    1 MVGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
116515583   1 MVGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
225859049   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
225860912   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
225856918   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
225854720   1 MAGSSREHAAWVLADYGFKVVIAGSFGDIHYNNELNNGLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
169833974   1 MAGSSREHAAWALANYGFKVVIAGTFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDHVTVDLEQQKIISPVEEFTFE 80 
182684018   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
221231946   1 MAGSSREHAAWVLADYGFKVVIAGSFGDIHYNNELNNGLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
194397849   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNDLLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
298502748   1 MAGSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFE 80 
15901116   81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
15903176   81 IDSKWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
116515583  81 IDSKWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
225859049  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
225860912  81 IDSKWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
225856918  81 IDSEWKHKLLNSLDDIGITLQYEELIVAYEKQRPAYWQD 119
225854720  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
169833974  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
182684018  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
221231946  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
194397849  81 IDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
298502748  81 IDSKWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap