Conserved Protein Domain Family
PRK14810

?
PRK14810: PRK14810 
formamidopyrimidine-DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 173271
View PSSM: PRK14810
Aligned: 3 rows
Threshold Bit Score: 452.054
Threshold Setting Gi: 116625750
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225873850   1 MPELPEVETVAQGVHERAHGQRILAAEFSRAREPFKTDPDTMAAVLTGQRIARVHRVGKHIVFDLETPR-PPKGkaepad 79 
94970892    1 MPELPEVETVANGLNKRAAGTTIESVWIGEKKQPLKSSARAIAKMLEGAKITLVRRVGKHIVADLAEPDgEPRG------ 74 
116625750   1 MPELPEVETVVRSLAPLV-GRRIATAEFRNLRILRGGDPDLMSARLAGRKILSIKRYGKFIVAVIEGGG----------- 68 
225873850  80 hQWIVHLGMTGRLLYSAASVPVPPHTHGRLSLSSGHELRFVDARRFGRMGLHsgARAQPFSGPGSEPLHISPEDFAALFR 159
94970892   75 -QWIIHLGMTGSTLVVDPDTPLPKHTHLIAKLSSGKELRFVDPRMFGKLAVR--AKSDVFAAPGLEPLTVSLEDFQKLFR 151
116625750  69 -HLMIHLGMTGKLLLGG---PSGKHTHAVLTFDRG-TLLFDDSRQFGCIEYSe-EFPKRVARLGPEPMEISFEDFAADLK 142
225873850 160 GRKLSIKAALLNQKLLHGVGNIYADESLYWAGIRPTRIAGSLSRERLLKLHAALQQVLRKAIELGGSSVSDYVDADGVRG 239
94970892  152 GRNTPIKSALLNQALLSGVGNIYADEALFRAGIRPRRRAKSLSRADLTRLHEKVGEVLREAVELGGSSVNDYVDAEGNEG 231
116625750 143 RRKTRIKSLLLNQTFIRGVGNIYADEALFRAGIHPQALTSRIRIERARKLYDAIGEVLTEAIEAGGSSISDYVDAEGRSG 222
225873850 240 FFQLEHRVYDRAGEPCRACAAEIRKMVHAGRGTHYCPRCQR 280
94970892  232 FFQLRHNVYQRTGEPCFTCKKPIKRVVIAGRSSHYCQNCQK 272
116625750 223 FFQFSHRVYQRTGEPCLNCKTPIRRVIVTQRSSHFCPHCQK 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap