Conserved Protein Domain Family
PRK14808

?
PRK14808: PRK14808 
histidinol-phosphate transaminase
Statistics
?
PSSM-Id: 173269
View PSSM: PRK14808
Aligned: 5 rows
Threshold Bit Score: 630.492
Threshold Setting Gi: 148270831
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15643798    1 MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDFLSKNNVS 80 
148270831   1 MNPLDLIARRAYPYETEKRDRTYLALNENPFPFPEDLVDEVFRRLNSDTLKIYYDSPDEELIEKILSYLNTDFLSKSNVS 80 
170289544   1 MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDFLSKNNVS 80 
222100500   1 MNPVDLIIKRAYPYETEKRDRIYLALNENPFPFPKELTEEVFRKLEGDKMRIYYDSPDEELIEKILEYLDADFLRENNVS 80 
281413126   1 MNPLDLIARRAYPYETEKRDRTYLALNENPFPFPEDLVDEVFRRLNSDTLRIYYDSPDEELIEKILSYLNTDFLSKNNVS 80 
15643798   81 VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI 160
148270831  81 VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI 160
170289544  81 VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI 160
222100500  81 IGNGADEIIYVMMLMFERAVFFPPTYSCYRIFAKAVGAKYLEIPLTKYLKIPEVDVGEGDVVFIPNPNNPTGHVFEREEI 160
281413126  81 VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI 160
15643798  161 ERILKTGAFVALDEAYYEFHGESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF 240
148270831 161 ERILKTGAFVALDEAYYEFHGESYVDLLKKYENLAVIRTFSKAFSLAAQRIGYVVSSEKFIDAYNRMRLPFNVSYVSQMF 240
170289544 161 ERILKTGAFVALDEAYYEFHGESYVDLLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF 240
222100500 161 EKILKKGAFVALDEAYYEFHGESYIDLLKEYENLAIIRTFSKAFSLAAQRIGYVISSEKFIDAYNRVRLPFNVSYVSQTF 240
281413126 161 ERILKTGAFVALDEAYYEFHGESYVDLLKKYENLAVIRTFSKAFSLAAQRIGYVVSSEKFIDAYNRVRLPFNVSYVSQMF 240
15643798  241 AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHLRTKNVAVRSFREGVRITIGK 320
148270831 241 AKVALDHREIFEERTKFIVEERERMKSILRKMGYRITDSRGNFVFIFMEKEEKERLLEHLRAKNIAVRSFREGVRITIGK 320
170289544 241 AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHLRTKNVAVRSFREGVRITIGK 320
222100500 241 AKVALEHIDIFKERIEYIVSERERMKKALKELNYSISDSRGNFVFIFMDRKEQNKLIEQLRQKNIAVRSFREGVRITIGK 320
281413126 241 AKVALDHREIFEERTKFIVEERERMKSILRKMGYRITDSRGNFVFIFMEKEEKERLLEHLRAKNIAVRSFREGVRITIGK 320
15643798  321 REENDMILRELEVFK 335
148270831 321 REENDMILKELEVFK 335
170289544 321 REENDMILRELEVFK 335
222100500 321 REENETILKELEVFR 335
281413126 321 REENDMILKELEVFK 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap