Conserved Protein Domain Family
PRK14804

?
PRK14804: PRK14804 
ornithine carbamoyltransferase; Provisional
Statistics
?
PSSM-Id: 173265
View PSSM: PRK14804
Aligned: 6 rows
Threshold Bit Score: 627.054
Threshold Setting Gi: 189911875
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24215540    1 MSESNVKHLISWEDWSDSEILDLLDFAIHVKKNRVNYAGHMSGRSLAMLFQKTSTRTRVSFEVAMTEMGGHGIYLDWMAS 80 
45657079    1 MSESNVKHLISWEDWSDSEILDLLDFAIHVKKNRVNYAGHMSGRSLAMLFQKTSTRTRVSFEVAMTEMGGHGIYLDWMAS 80 
116331570   1 MSESNIKHLISWEDWSDSEILDLVNFAVHVKKNRVNYAGHMSGRSLAMLFQKTSTRTRVSFEVAMTEMGGHGIYLDWMAS 80 
116327770   1 MSESNIKHLISWEDWSDSEILDLVNFAVHVKKNRVNYAGHMSGRSLAMLFQKTSTRTRVSFEVAMTEMGGHGIYLDWMAS 80 
189911875   1 --MSQVKHLISWKDWTDGEIQELLDFAVYVKKNRVYFSGHMSGRSLAMLFQKTSTRTRVSFEAGMTELGGHAIFLDWMAS 78 
183221801   1 --MSQVKHLISWKDWTDGEIQELLDFAVYVKKNRVYFSGHMSGRSLAMLFQKTSTRTRVSFEAGMTELGGHAIFLDWMAS 78 
24215540   81 NFQLSDIDLEARYLSRNVSVIMARLKKHEDLLTMRNGSQVPLINGCDNMFHPCQSLADIMTIALDKPEIPLNQIQLTYIG 160
45657079   81 NFQLSDIDLEARYLSRNVSVIMARLKKHEDLLTMRNGSQVPLINGCDNMFHPCQSLADIMTIALDKPEIPLNQIQLTYIG 160
116331570  81 NFQLSDIDLEARYLSRNVSVIMARLKKHEDLLLMKNGSQVPVINGCDNMFHPCQSLADIMTIALDAPERPLNQTKLTYIG 160
116327770  81 NFQLSDIDLEARYLSRNVSVIMARLKKHEDLLLMKNGSQVPVINGCDNMFHPCQSLADIMTIALDAPERPLNQTKLTYIG 160
189911875  79 NFLLSDIDFEGKYLSSNVAIIMARLKKHEDLLVLKSGSTVPVINGCCNLFHPCQSLADILTIVMDSPN-DWKKKQVCYIG 157
183221801  79 NFLLSDIDFEGKYLSSNVAIIMARLKKHEDLLVLKSGSTVPVINGCCNLFHPCQSLADILTIVMDSPN-DWKKKQVCYIG 157
24215540  161 VHNNVVNSLIGITSALGIRLTLVTPIAEKENIHSQTVERAKAKGTLSWEENLKKAIQNADYVYTDTWLDMEFFNDPSYAD 240
45657079  161 VHNNVVNSLIGITSALGIRLTLVTPIAEKENIHSQTVERAKAKGTLSWEENLKKAIQNADYVYTDTWLDMEFFNDPSYAD 240
116331570 161 VHNNVVNSLIGITAALGVHLTLVTPI--KENIHPQTVERAKSKGTLTWEQNLEKSVKDADYVYTDTWLDMEFFNDPSYAD 238
116327770 161 VHNNVVNSLIGITAALGVHLTLVTPI--KENIHPQTVERAKSKGTLTWEQNLEKSVKDADYVYTDTWLDMEFFNDPSYAD 238
189911875 158 VHNNVANSLVEITAALGIHLILVTPIAAKESIVAEAIDRAQKKGTVSWEMDVHKAVSHADYVYTDTWVDMEFFNDPKYQK 237
183221801 158 VHNNVANSLVEITAALGIHLILVTPIAAKESIVAEAIDRAQKKGTVSWEMDVHKAVSHADYVYTDTWVDMEFFNDPKYQK 237
24215540  241 KKKQRMELMMPYQINSSLLEKTNAKVMHDMPIHAGYEITREVVLGPRSIIFQQAENRLDAQKAVILKLLEA 311
45657079  241 KKKQRMELMMPYQINSSLLEKTNAKVMHDMPIHAGYEITREVVLGPRSIIFQQAENRLDAQKAVILKLLEA 311
116331570 239 KKKQRMELMMPYQINSSLMEKTNAKVMHDMPIHAGYEITREVVLSQRSIIFQQAENRLDAQKAVILKLLEV 309
116327770 239 KKKQRMELMMPYQINSSLMEKTNAKVMHDMPIHAGYEITREVVLSQRSIIFQQAENRLDAQKAVILKLLEV 309
189911875 238 EKEERIQMMMPYQVNADLMKHSKAKVMHDMPIHAGYEITREMVESDRSIIFTQAENRLDAQKAVILKLLEN 308
183221801 238 EKEERIQMMMPYQVNADLMKHSKAKVMHDMPIHAGYEITREMVESDRSIIFTQAENRLDAQKAVILKLLEN 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap