Conserved Protein Domain Family
PRK14795

?
PRK14795: PRK14795 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173256
View PSSM: PRK14795
Aligned: 29 rows
Threshold Bit Score: 191.361
Threshold Setting Gi: 121601961
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222084675  11 AAKPALFSrplpILIFIIIAVILDQAVKIMVDHWLPLQEMVPVIPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLVIVAF 90 
163867315   1 MIRKSLLF----LLLGLTLTAGLDQAVKYWVMQNMPLGTEIPLIPFLSLYHVRNSGIAFSFFSSFSHWGIIAITIIVIIF 76 
227820614   2 SERNTLFSrplpIALFILVALVADQAIKYLVEAFLPFQEAVPVVPMLALYRTYNYGVAFSMLSGMEGWFIVGMRLAVVAF 81 
222147335   2 TRSAALFCrpvpAILFILSLLILDQAIKYAVEVSLPMHELVPVVPMLGLFRTHNLGVAFSMLSHLDAWVIVVMRLAIVAF 81 
240849691   1 MMRKSLPF----LLLGLAFTVVLDQAVKYWVMHNMPLGTEISLIPFLSLYHVRNSGIAFSFFSSFSHWGIIAITIIVIIF 76 
150395254   1 MQERTLFSrplpIALFILTALAADQFIKYLVEAFLPFQQGVPVVPMLALYRTYNYGVAFSMLSGMEGWFIVGIRLGVVTF 80 
15964144    2 RQEQTLFSrplpIALFILIALAADQFIKYLVEAYLPFQQGVPVMPMLALYRTYNYGVAFSMLSGMEGWFIVGIRLAVVTF 81 
15887692    1 MAKAALFSkfapAFTLIAAALVLDQIVKQLVEAYLPLQEMVPVAPFLALYRTYNLGVAFSMLEDMHGWFIVSMRLVIVVF 80 
49473697    1 MTRKSFSF----FLLGLILTVGIDQTVKYWIMHNMLLGTEIPLLPFLSLYHVRNSGIAFSFFSSFSHWGLIALTLIILIF 76 
49474841    1 MTRKSFPF----FLLGLILTVGIDQAVKYWVMHNIPLGTETPLLPFLSLYHVRNSGIAFSFFSSFSHWGLIFLTLIILIF 76 
222084675  91 VIWLWRRTPDHRWIAHLGFALIIAGALGNLIDRFLYGHVIDYVLFHTE-TWSFAVFNLADSFITIGAGCVILDELLSPKK 169
163867315  77 LLWLWKNTEDNKFLMRFGLVLIIGGAIGNLIDRIRFHHVTDYILFYIDdIFYFAIFNLADSFITLGVIVILIEELRTWMK 156
227820614  82 VLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVIDYILFHTA-TWSFAVFNLADSFITVGAGAIILDELLQTKK 160
222147335  82 VAWLWRQTSRDHQFAHLGYCLIIAGAFGNIIDRFTYGYVVDYILFHTE-TWSFAVFNLADSLITIGAGFILLEELLVLRR 160
240849691  77 LLRLWKNTEHNKSLMRFGLILIIGGAIGNLVDRIRFHHVTDYILFHIDdIFYFAIFNLADSFITLGVIAILIEELRTWMK 156
150395254  81 VLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVIDYILFYTA-TWSFAVFNLADSFITVGAGAIILDELLQAKK 159
15964144   82 VLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVIDYILFYTA-TWSFAVFNLADSFITVGAGAIILDELLQAKK 160
15887692   81 VLWLWRKTAADRTFAHLGFAFIIAGAAGNLLDRFFYGHVIDYILFHTQ-TWSFAVFNLADSFITIGAACVILDEFLHARA 159
49473697   77 LLWLWKNTEYNKFLSRFGLTLIIGGAIGNLIDRICFYYVIDYILFYIDdIFYFAVFNLADTFITLGVIAIVTEELRIWIK 156
49474841   77 LLWLWKNTQYNKSLTRFGFTLIIGGAIGNLIDRICFYYVIDYILFYINdVFYFAVFNLADTFITLGVIAIIIEELLSWIK 156
222084675 170 ANT 172
163867315 157 AKR 159
227820614 161 TRS 163
222147335 161 SKG 163
240849691 157 EKR 159
150395254 160 ERS 162
15964144  161 ERS 163
15887692  160 AKK 162
49473697  157 EKR 159
49474841  157 RKS 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap