Conserved Protein Domain Family
PRK14794

?
PRK14794: PRK14794 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173255
View PSSM: PRK14794
Aligned: 3 rows
Threshold Bit Score: 218.368
Threshold Setting Gi: 213155666
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110834230   1 MAYGESISVTPFFNWVHVWNTGAAFSLFANGGGWQRYFLIGIAVVVSIFLIKLILENRHKGEAFAYSLILGGAMGNLIDR 80 
213155666   1 MAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLILGGAMGNLIDR 80 
213155623   1 MAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLILGGAMGNLIDR 80 
110834230  81 IFRGYVVDSFDFYWRDWHWPAFNLADIAIVTGALLFVSGSLLGEKTNTNTNPDRQG 136
213155666  81 VFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKANTNAESDGSD 136
213155623  81 VFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKANTNAESDGSD 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap