Conserved Protein Domain Family
PRK14790

?
PRK14790: PRK14790 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173251
View PSSM: PRK14790
Aligned: 5 rows
Threshold Bit Score: 254.783
Threshold Setting Gi: 148654436
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156740303   8 LRHELQRYWLRPAVIAATILAFDQATKAWVLNTLGTVEGTS-RPLIGDWLSLTLIHNTGIAFGMFDaGFSHVFTATSLII 86 
222524260   1 MKSLVQARWITPILVAIIAVALDQASKRWIVATLGPEPMTKfIPLIGEDIRLAYSHNTGIAFSLFQ-GKSDILTIVALVI 79 
163846481   1 MKSLVQARWITPILVAIIAVALDQASKRWIVATLGPEPMTKfIPLIGEDIRLAYSHNTGIAFSLFH-GKSDILTIVALVI 79 
219849169   1 -MKLLQARWITPLLVAALVIGLDQASKRWIIDTLGPTPMTRfIPLIGEDIRLAYSHNTGIAFSLFQ-GKSDILTVVAFVI 78 
148654436   8 IGRELRRYWLGPAAIAATILALDQVTKAWVLETLGTVEGTT-RPLLGDWLSLTLIHNTGIAFGMFDvGFPHFFTVTSIII 86 
156740303  87 SLGAMYFYRYHLPGPHLISQVCLGLIVGGAIGNIIDRLRFGYVIDFVHVHWFPgIFNVADSAITVGVAVLALFLLLTGDG 166
222524260  80 ITGAIYLYITQLPNRRRLIQIAMGLILGGALGNVIDRIRLGYVVDFIQVGWFP-IFNLADSAITVGAALLMLQYALDEIA 158
163846481  80 ITGAIYLYITQLPNRRRLIQIAMGLILGGALGNVIDRIRLGYVVDFIQVGWFP-IFNLADSAITVGAALLMLQYALDEIA 158
219849169  79 MSGAIYLYVTQLPNRRKLVQVAMGLILGGALGNVIDRIRLGYVVDFIQVGWFP-IFNLADSAITVGAALLMLQYALDEIA 157
148654436  87 SLGAMYFYRYHLPGPHLLPQVCLGLIVGGAIGNIIDRLRFGYVIDFIHVHWFPgIFNVADSSITVGVAILALFLALIGDG 166
156740303 167 DQRragsddaLLNDLLNQ 184
222524260 159 LRR-------VRQAMMSQ 169
163846481 159 LRR-------VRQAMMSQ 169
219849169 158 LRR-------LRQAMMSQ 168
148654436 167 EQRraaaddaLLNDLLSR 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap