Conserved Protein Domain Family
PRK14789

?
PRK14789: PRK14789 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173250
View PSSM: PRK14789
Aligned: 3 rows
Threshold Bit Score: 285.777
Threshold Setting Gi: 163846480
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219849170   1 MRKRWMLLMFVAVPVVILDQLSKAWLSTVLLRVNRPISLLFDWVQLAYYENTGVAFGLFPDQGGVLSISAGFILLVLALT 80 
163846480   4 LRSRWMLLVLVAIPVFVIDQLSKVWLSDVLLRYNRPIPLLFDWVQLAYHENTGVAFGLFPDQGGVLSVGAGLVLLLLALT 83 
222524259   4 LRSRWMLLVLVAIPVFVIDQLSKVWLSDVLLRYNRPIPLLFDWVQLAYHENTGVAFGLFPDQGGVLSVGAGLVLLLLALT 83 
219849170  81 YQYLLPAESRWVTVATGLVFGGGLSNLFDRLRQGYVVDFIQFGWWPMFNLADSAITLGVAALAFHIIFIGDEPSGIEPEP 160
163846480  84 YQYILPADSRWITVAVGMIFGGGLSNLVDRIRQGYVVDFIQFGWWPVFNLADSAITIGVAALAFHIIFIGEEPAPTEPEP 163
222524259  84 YQYILPADSRWITVAVGMIFGGGLSNLVDRIRQGYVVDFIQFGWWPVFNLADSAITIGVAALAFHIIFIGEEPAPTEPEP 163
219849170 161 IDDGLLNELLSRAPESPSPTEPSQRNSELPS 191
163846480 164 IDDELLSELLSRDPSPPAATDARTSSSESLS 194
222524259 164 IDDELLSELLSRDPSPPAATDARTSSSESLS 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap