Conserved Protein Domain Family
PRK14787

?
PRK14787: PRK14787 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173248
View PSSM: PRK14787
Aligned: 11 rows
Threshold Bit Score: 220.258
Threshold Setting Gi: 193213292
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189500704   1 MQLFFLCAALVIVLDQFTKQLAITHLMPnEESLVLIAEWLKLTYTENTGIAFGLSLGSPMILIVSTTLILAALFLYVVFS 80 
189347287   1 MKWFFTFASVVVLLDQFTKKLAVLFLRD-RGTVTIIPDWLKLTYAENNGIAFGVEFASQAIMILLVGSISLMIALYVLKS 79 
193215313   1 -MKIFLIAIAVIVVDQVTKFLAKELLFHgPGVVPLIGDWLKLTYTENRGIAFGLEMGGPLFVTGFAIAATIGICYYLYIS 79 
193213292   1 MVQFYLLTLVFIVVDRFAKLFAINVLRDlPNGIVLVPDWFKLMYAENLGIAFGLRLLPPEGILLLALAISAGLTWYVWIS 80 
194337097   1 MKLFFSIVLLVITLDQFTKKLALTFLRDgVQSITIIADLFSLTYAENRGVAFGLEFAPPTVLLLLTGVITIMVLAYVIWS 80 
194334460   6 MIWFVTIAISVIILDQITKILAISYLKE-PGSITIIPDWFKLTYTENTGIAFGVDPGSRMILVGGTAAILAGILIYVLLS 84 
145219353   1 MRWFFFLLLSVIGLDRFTKQLAIIFLRDtGESITIIPGLFSLTYAENRGIAFGMEFLPPGVLLILTTIIVSGVIIYALYQ 80 
119356542   1 MNWFFTLASIVIVLDQLTKKIAVMILKE-KESVTLIPDWLKFTYAENNGIAFGMEFAPKEVMILLVGTISLLIALYVFRS 79 
78189311    1 MKLFFSLALFVVAADQFSKYVALRFLRDaNQSISIIPNFFSFTYAENRGIAFGLEPAPPALLLLFTMMISAAVLWYVLRS 80 
78186370    1 MKMFSMLALFVIAADQFTKKLAVFFLRDmQQSITIIPDFFSFTYAENRGVAFGMEFAPPFVLLMLTGAIVLGVLVFVARS 80 
21674624    1 MALFYLLAIAAALLDRVTKLLAIHYLRDgAQSIVIIPDWLKLTYAENLGIAFSVRFLPPTGLLFLTLAISAGVVWYVHKS 80 
189500704  81 KNRNPGFLITFGLILGGGIGNGIDRILSGRVVDFIHVDIYQGYLFGSWVSLWPVFNIADSAITIGACVLVIWYNRFFTR 159
189347287  80 GNRKTLFLLPFSLIFGGGIGNLIDRLTVGRVIDFIHFDLYQGTIMGSWVSLWPIFNVADSAITIGACMLILLHNRIFPE 158
193215313  80 RRDNIYYTTAFGLILGGAIGNLIDRFAYGQVIDFIHFDLYRGYIFGNYLALWPIFNIADSAITIGVCVMLIWYNHIFEE 158
193213292  81 QNRSPLFILTFALILGGGLGNLIDRLIFGHVVDFIYFDIYQGTLFGKYVSLWPIFNIADACITIGACLLFFFHDKIFNP 159
194337097  81 KNRTTLFLLPFALITGGGIGNMIDRVMYGKVVDFIYFDLYQGHIFGRWVSLWPIFNIADSAITIGACMLMIFHNKLFPA 159
194334460  85 KNRTPGFLTAFALILGGGAGNLLDRATSGRVTDFLHLDLYNGYIFNTWMSLWPVFNIADSAITIGAFMLLLWHNSIFSD 163
145219353  81 GNRQPLFLGSFGLIAGGGIGNLIDRFTTGRVVDFLYFDLYRGELFGQWIALWPIFNIADSAITIGACMLIIFYGRIFPD 159
119356542  80 KNRTTRFILPFALVFGGGVGNMIDRITGGKVIDFIHIDLYNGMIMGTWVSLWPIFNIADSAITIGACLLILFHSTIFPD 158
78189311   81 NNRRLIFLLPFSLILGGGVGNMIDRMVRGYVVDFIYFNLYNGYVGNIYLSLWPIFNIADSAITIGGTMLLLFHRTLFPD 159
78186370   81 RNRTPIFLSAFGLIAGGGIGNMIDRIASGRVTDFIYFDLYKGELFGHWVSLWPIFNVADSAITIGACMLVLFYNRIFPD 159
21674624   81 NNRSPLFLTAFGLILGGGIGNLIDRVMLGHVVDFIYFDLYHGALFGIPLDLWPIFNVADSCITIGACMIVLFHEKIFTR 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap