Conserved Protein Domain Family
PRK14786

?
PRK14786: PRK14786 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173247
View PSSM: PRK14786
Aligned: 5 rows
Threshold Bit Score: 150.514
Threshold Setting Gi: 146295536
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146295536   1 MFYIFIITILTGIDQWTKYLIETQLKPIGAIPIVKDIFHLTYARNTGAAFSILRDKQAFLILVTTIVVGALIYYLIKILK 80 
167039921   1 MFYIFIITILTGIDQWTKYLIETQLKPIGAIPIVKDIFHLTYARNTGAAFSILRDKQAFLILVTTIVVGALIYYLIKILK 80 
160901914   1 MFYIFIITILTGIDQWTKYLIETQLKPIGAIPIVKDIFHLTYARNTGAAFSILRDKQAFLILVTTIVVGALIYYLIKILK 80 
158320118   1 MNYFIIIALLVAIDQVFKYLVESYLKPIGTFPIIKDVFHLTYGQNTGAAFSILQGKQAFLITVTSIVTIALIVYLIKNYK 80 
304316306   1 MFYIFIITILTGIDQWTKYLIETQLKPIGAIPIVKDIFHLTYARNTGAAFSILRDKQAFLILVTTIVVGALIYYLIKILK 80 
146295536  81 TGEVAFKLSLAIIIGGALGNLIDRVRLNYVTDFLDFTLINYPIFNLADVFVVSGVVMLSYMLLFKGDMPKISKM 154
167039921  81 TGEVAFKLSLAIIIGGALGNLIDRVRLNYVTDFLDFTLINYPIFNLADVFVVSGVVMLSYMLLFKGDMPKISKM 154
160901914  81 TGEVAFKLSLAIIIGGALGNLIDRVRLNYVTDFLDFTLINYPIFNLADVFVVSGVVMLSYMLLFKGDMPKISKM 154
158320118  81 TQNYLLLISLTLVISGALGNLIDRVRLNYVVDFLDFTLINYPIFNTADIFVVSGTTLLAYFMLLASPNNSQKEG 154
304316306  81 TGEVAFKLSLAIIIGGALGNLIDRVRLNYVTDFLDFTLINYPIFNLADVFVVSGVVMLSYMLLFKGDMPKISKM 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap