Conserved Protein Domain Family
PRK14783

?
PRK14783: PRK14783 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173244
View PSSM: PRK14783
Aligned: 6 rows
Threshold Bit Score: 295.236
Threshold Setting Gi: 183221136
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183221136   1 MKLPKTPFFSVFKPGYLAFVAFGLFLDLSSKYVIITKMYAHESIPVLGDFFRLSLTFNTGFVFGLFQDNALPSLFATGFA 80 
189911227   1 MKLPKTPFFSVFKPGYLAFVAFGLFLDLSSKYVIITKMYAHESIPVLGDFFRLSLTFNTGFVFGLFQDNALPSLFATGFA 80 
24214036    1 MKYFEKRFLDVYRPIYLGVIFLGIVLDLVTKFLVILYFQPHRYLEVFGSFFRMTLTFNTGFVFGAFQDNAIPSLIATGVA 80 
45658235    1 MKYFEKRFLDVYRPIYLGVIFLGIVLDLVTKFLVILYFQPHRYLEVFGSFFRMTLTFNTGFVFGAFQDNAIPSLIATGVA 80 
116327613   1 MKYFEKRFLDVYRPLYIGVIFLGIILDLVTKFLVILYFEPHRYLEVLGSFFRMTLTFNTGFVFGAFQDNAIPSLIATGIA 80 
116331776   1 MKYFEKRFLDVYRPLYIGVIFLGIILDLVTKFLVILYFEPHRYLEVLGSFFRMTLTFNTGFVFGAFQDNAIPSLIATGIA 80 
183221136  81 IVFLIFYRWENSDLGNAWGWNFVMAGAFGNFLDKFFVKIPGSGFRFGFTPEKPgiEFIGVVDFLDFEWPDFLLFDRWPAF 160
189911227  81 IVFLIFYRWENSDLGNAWGWNFVMAGAFGNFLDKFFVKIPGSGFRFGFTPEKPgiEFIGVVDFLDFEWPDFLLFDRWPAF 160
24214036   81 IVFLIGYRWKNHDLGNPWGWNLVMAGAFGNFLDKFFVKIPGTGFRFGFQPNMG--EYIGVVDFLDFDWPDFLLFSRWPAF 158
45658235   81 IVFLIGYRWKNHDLGNPWGWNLVMAGAFGNFLDKFFVKIPGTGFRFGFQPNMG--EYIGVVDFLDFDWPDFLLFSRWPAF 158
116327613  81 IVFLIGYRWKNYDLGNPWGWNLVMAGAFGNFLDKFFVKIPGTGFRFGFQPNVG--EYIGVVDFLDFDWPDFLLFSRWPAF 158
116331776  81 IVFLIGYRWKNYDLGNPWGWNLVMAGAFGNFLDKFFVKIPGTGFRFGFQPNVG--EYIGVVDFLDFDWPDFLLFSRWPAF 158
183221136 161 NVADSCVSIGIVILLFTMDWKEMD 184
189911227 161 NVADSCVSIGIVILLFTMDWKEMD 184
24214036  159 NVADSCVTIGLTILIFTMKLEEEK 182
45658235  159 NVADSCVTIGLTILIFTMKLEEEK 182
116327613 159 NVADSCVTIGLTILIFTMKLEEEK 182
116331776 159 NVADSCVTIGLTILIFTMKLEEEK 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap