Conserved Protein Domain Family
PRK14782

?
PRK14782: PRK14782 
signal peptidase II
Statistics
?
PSSM-Id: 173243
View PSSM: PRK14782
Aligned: 4 rows
Threshold Bit Score: 242.367
Threshold Setting Gi: 99079933
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
99079933    3 SYALYLAALIALIVDQATKIGVVFGLDLVRVLRIDVAPPLLNFRYGENRGINFGLFNDGGDSSRWILIGISLIICAAVFL 82 
110678033   1 MRLLYGAAVIAFLVDQVSKYIVIHMMELWRIRAVDVFPPFVNFRYGENRGINFGLFDGGSDAARWALIGVALAICTFVYI 80 
56698197    3 ARLLFWSAFWAFLIDQISKYLVVHVMDVAHRGSIEVLPPFLTFRYGENRGINFGLFQGESDAARWILIGLSLVICAVVVV 82 
159042915   1 MRALALSAVVAFAIDQLSKLVVVHWLNLKEIRAIDVLPPVLNFRMGWNHGVNFGLFGSDSEAMRWALIVLALAICAGVVI 80 
99079933   83 WVRRSHAnSRLMLISAGLVIGGALGNVLDRVLYGYVLDFLNMSCCGINNPYVFNVADVFIFAGAAGLILFEGRAKKPA 160
110678033  81 WSRKSQL-AGWAAAAAGLLIGGALANVLDRLIYGYVLDFLNMSCCGIDNPFVFNLADVFIFMGAIGLVFLAPDPKADA 157
56698197   83 WLSRGRP-SRWMLIGGGLLIGGALGNVIDRLIYGYVLDFLNMSCCGINNPFVFNVADIFIFGGAAALILLDGKKPS-- 157
159042915  81 WVRREGG-GTRVMVSAGLLVGGALANVLDRVIYGAVADFLNVSCCGIRNPFTFNLADVAIFAGALGLVLFTGKTDENP 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap