Conserved Protein Domain Family
PRK14778

?
PRK14778: PRK14778 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173239
View PSSM: PRK14778
Aligned: 7 rows
Threshold Bit Score: 265.138
Threshold Setting Gi: 222099184
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15643229    1 MAFVMVLTIVLDQLTKRIASEIHG-TFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLE 79 
148269597   1 MAFVMVLTIVLDQLTKRIASEIHG-TFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLE 79 
150020880   1 -MFWITLAFVIDQITKYIATNYWRfNPKKVL-FFYFTYATNKGVAFGLFSNSKEIVVYLTLAITIFLSIIPLVKRLDFLT 78 
170288273   1 MTFVMVLTIVLDQLTKRIASEIHG-TFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLE 79 
222099184   1 MSFVIVLTLVLDQLTKKIASAVHG-TFYLVPGFLKFVKATNRGIALGLFSNLSEQVLWIVLFVVVVLSLFPYMFRFSRLE 79 
217077317   1 -MFWITLAFVIDQITKYIATEYWRfNPTRLFNFFYLTYATNKGVAFGLFSNSKEIVIYLTLAIIIGLSIIPLFKRLNFWT 79 
281411685   1 MAFVMVLTIVLDQLTKRIASEIHG-TFFIVPGFLRFVKATNRGVALGLFKNLSEQLLWTVMFVVVFLSLLPYIFKFSRLE 79 
15643229   80 RIAMGFILGGALGNLLDRIRFGYVLDFLNLTFLPTIFNLADVFIIVGGALMILGVFRGGDNESLESRKKRRGLETGSVFE 159
148269597  80 RTAMGFILGGALGNLLDRIRFGYVLDFLNLTFLPTIFNLADVFIIVGGALMILGVFRGGDNESLESRKKRRGLETGSVFE 159
150020880  79 NMFLGFIIGGALGNVVDRIRFGYVVDFVTMPYWPTIYNLADFFILLGGIGIAIISLRRRDVGN-SSNSTGEGLEIRQIYS 157
170288273  80 RIAMGFILGGALGNLLDRIRFGYVLDFLNLTFLPTIFNLADVFIIVGGALMILGVFRGGDNESLESRKKRRGLETGSVFE 159
222099184  80 RVAMGFILGGALGNLLDRIRFGYVLDFLNLVFLPTIFNLADVFIIVGGGLMILGAFRGVSDEKLESGEKGRRLETRSVSE 159
217077317  80 NMFLGFIIGGALGNVVDRIRFGYVVDFITMPYWPTIYNLADFFILVGGIGIGLVLLWRRDIGD-QRNSERERLEIGQIRS 158
281411685  80 RIAMGFILGGALGNLLDRIRFGYVLDFLNLTFLPTIFNLADVFIIVGGALMILGVFRGGDNESLESRKKRRGLETGSVSE 159
15643229  160 GEDTIMDLEINDSKSDKRGQSEGQRSD 186
148269597 160 GEDTVMDLEITDSKSDKRGQSEGQRSD 186
150020880 158 RKSTRLDIENVHSKSDQEWNGNSK--- 181
170288273 160 GEDTVVDFEITDSKSDKRGQSEGQRSD 186
222099184 160 REDSIVDIQVDDTEGDKGRKGEGQRPD 186
217077317 159 GESTELDFKDVHSESDKDWGDKSQ--- 182
281411685 160 GKDTVMDLEINDSKSDKRGQSEGQRPD 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap