Conserved Protein Domain Family
PRK14776

?
PRK14776: PRK14776 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173237
View PSSM: PRK14776
Aligned: 25 rows
Threshold Bit Score: 304.165
Threshold Setting Gi: 169797585
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56460349    1 MLIIGKKLSPYALLSISGLLAASDQAVKWLVQQSMAYGEYVSVTPFFNWVHLWNTGAAFSLFANGGGWQRYFFIGIAVAV 80 
146291307   1 MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
146291333   1 MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
120597350   1 MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
120597246   1 MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
120597271   1 MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
121595767   1 MLIIGKKLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
184156556   1 MSIFGKHLSPYALLSISGLLAASDQAIKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
169797585   1 MSIFGKHLSPYALLSISGLLAASDQAIKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
169797519   1 MSIFGKHLSPYALLSISGLLAASDQAIKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVV 80 
56460349   81 SIFLIKLILENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSGSFLGKKT 160
146291307  81 SIFLIKLILENRHKGEAIACSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
146291333  81 SIFLIKLILENRHKGEAIACSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
120597350  81 SIFLIKLILENRHKGEAIACSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
120597246  81 SIFLIKLILENRHKGEAIACSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
120597271  81 SIFLIKLILENRHKGEAIACSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
121595767  81 SIFLIKLILENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
184156556  81 SIFLIKLILENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKA 160
169797585  81 SIFLIKLIFENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKA 160
169797519  81 SIFLIKLILENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKA 160
56460349  161 NTNAESDGSD 170
146291307 161 NTNAEPDGSD 170
146291333 161 NTNAEPDGSD 170
120597350 161 NTNAEPDGSD 170
120597246 161 NTNAEPDGSD 170
120597271 161 NTNAEPDGSD 170
121595767 161 NTNAESDGSD 170
184156556 161 NTNAESDGSD 170
169797585 161 NTNAESDGSD 170
169797519 161 NTNAESDGSD 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap