Conserved Protein Domain Family
PRK14774

?
PRK14774: PRK14774 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173235
View PSSM: PRK14774
Aligned: 4 rows
Threshold Bit Score: 272.277
Threshold Setting Gi: 146278961
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146278961   1 MRLTALTALIVFLIDQATKWIVVWGLGLAHRGAIDLVAPWLTFRMAWNRGINFGIGSSDQEIVRWGLIAVSLAISAWVWR 80 
77464682    1 MRLAALTAFGVFVLDQLTKWLVVWGLDLANRGAIDLVAPWLTFRMAWNRGINFGIGSSDQEIVRWGLVIVSLAISAWVWR 80 
126463522   1 MRLAALTAFGVFVLDQLTKWLVVWGLDLANRGAIDLVAPWLTFRMAWNRGINFGIGSSDQEIVRWGLVIVSLAISAWVWR 80 
221640596   1 MRLAALTAFGVFVLDQLTKWLVVWGLDLANRGAIDLVAPWLTFRMAWNRGINFGIGSSDQEIVRWGLVIVSLAISAWVWR 80 
146278961  81 WVGRSEPSRMARVSGGLLIGGAIGNVVDRILYGAVADFLNMSCCGIENPYAFNVADIAIFAGAFGLVLFTRETKPAPGKA 160
77464682   81 WVWRSTPTRLARISGGLLIGGALGNVVDRVLYGAVADFLNMSCCGIENPYAFNVADIAIFAGAFGLVLFTRETKPEPEKL 160
126463522  81 WVWRSTPTPLARISGGLLIGGALGNVVDRVLYGAVADFLNMSCCGIENPYAFNVADIAIFAGAFGLVLFTRETKPEPEKP 160
221640596  81 WVWRSTPTRLARISGGLLIGGALGNVVDRVLYGAVADFLNMSCCGIENPYAFNVADIAIFAGAFGLVLFTRETKPEPEKP 160
146278961 161 gAGAAKRKPSDGKSSGSGRRGGGKTP 186
77464682  161 -KSTPKRKPAERKANGSGRPGGGKTP 185
126463522 161 -KGTPKRKPAERKANGSGRPGGGKTP 185
221640596 161 -RGTPKRKPAERKANGSGRPGGGKTP 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap