Conserved Protein Domain Family
PRK14773

?
PRK14773: PRK14773 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173234
View PSSM: PRK14773
Aligned: 6 rows
Threshold Bit Score: 302.15
Threshold Setting Gi: 108757607
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108757607   1 MKVSHRFVLLVIVAVLAADQVTKYLAVSRLTDALD--GREGLA-RVTGFVTEQNLDnrpPPEDGSYRVLRPYrfiedyWH 77 
220915136   4 PVSKWALLALLFAALLAADQWTKYLAVERLTVVFErgGDETLAeRVRGFYTYRHLE---PLSTEPYYVWRPV------WR 74 
197120434   4 PVSKWALLALLFAALLAADQWTKYLAVERLTVVFErgGDETLAeRVRGFYTYRHLE---PLSTEPYYVWRPV------WR 74 
108762828   1 MPRKYIILLAVTLGVIVLDQWTKYLVVRELTTQME--GKESLGeRLASMYSEPPPK---GFTGMHYQPRRHIeisesfFR 75 
153002893   6 PFSKWALLALLFVTLVAIDQWTKYLAVERLTTLFErtGAETLGeRLAGFLEHQHLE---PISTDPYYVWRPV------WR 76 
86156443    4 PVSKWALLALLFTALLAADQWTKYLAVERLTVVFErgGDETLAeRVRGFYTYRHLE---PLSTEPYYVWRPV------WR 74 
108757607  78 FRYVENPGAAWGIFGDMPEGVRRLFFLVVSLAAMGFIFVMYRRTP---MEQRLARVALALVTGGALGNFVDRLLRGYVID 154
220915136  75 MNYVENPGAAWGLFRGHSQLFRNAFFTLVSLAAVAFILHYYRKLR---QDQRYLQVALALVLAGAVGNFVDRLARRYVID 151
197120434  75 MNYVENPGAAWGLFRGHSQLFRNAFFTLVSLAAVAFILHYYRKLR---QDQRYLQVALALVLAGAVGNFVDRLARRYVID 151
108762828  76 IRYLENPGAAWGMFRSMPPEARVPLFHVAIIGALILITFSFRKLTgtdPEEKWALWGLPLVLGGALGNYIDRVARAFVID 155
153002893  77 MNYVENPGAAWGLFRGHSEAFRNGFFTLVSLGAVAFILHYYRKLR---AEQRYLQVALALVLSGAVGNFLDRLARGYVID 153
86156443   75 MNYVENPGAAWGLFRGHSQFFRNAFFTLVSVAAVAFILHYYRKLR---QDQRYLQVALGLVLAGAVGNFVDRLARRYVID 151
108757607 155 FIDWHWRNQPGMRWPTFNVADVAISVGVGLMLLDSLRAPKSPNP 198
220915136 152 FVEWYWWNRPDLRWPTFNVADSLIVVGVAMLVLHPGSKREAARA 195
197120434 152 FVEWYWWNRPDLRWPTFNVADSLIVVGVAMLVLHPGSKREAARA 195
108762828 156 FLEVHWFDKAT--FPSFNVADAAICIGVGMLIIDSFVRKEKPAQ 197
153002893 154 FIEWYWWNRPDIRWPTFNIADSLIVVGVALLVLHPGSGKAAQKA 197
86156443  152 FIEWYWWNRPDIRWPTFNVADSLIVVGVAMLVLHPGSRREAARA 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap