Conserved Protein Domain Family
PRK14770

?
PRK14770: PRK14770 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173231
View PSSM: PRK14770
Aligned: 5 rows
Threshold Bit Score: 234.714
Threshold Setting Gi: 148259646
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
258541834   1 MSSRPFMLRPAgLGLLVLMLTLSADQLSKYWILYGLDLPARGSVKVLPFLNFTMVWNHAVTFGMFGGlgGAGRIVFSAIA 80 
148259646   3 GASRGNASRRT-LGALMALAVLAIDQASKAWILYGLDLPRKGSVPVLPVLNFTMVWNHGVTFGILAG--DDARLLLIAVA 79 
58039703    7 GMSRTGRMV---LGFALLVLVLVLDQASKDWILYVYHLPDRGSVEILPFLNFTMVWNHAVTFGMFGGlgSRGPWIFCAVS 83 
162146415   8 AIPRPVRLCRT-LGAALFIAVLLLDQVSKYWILHGFDLPDRGSVPLLPGLNFTMVWNRAITFGMLGGmaGIGRVVFSVVS 86 
209543576   8 AIPGPARLCRA-LGAALFVAVLLLDQGSKYWILHGFDLPDRGSVPLLPGLNFTMVWNRAITFGMLGGmaGIGRVVFSVVS 86 
258541834  81 LAVACCLLVWIFRTPSKLTAACVGAITGGAIGNVMDRVRYGAVVDFLHAHAFGWSWYVFNVADSAIVCAVCMLLVQNFLA 160
148259646  80 IAAIAGLSVWLWRTPSLLAALGLGAIIGGAAGNVISRIAYGAVVDFVDVHVGNLHWYVFNLADAAIDGGVAALIIESLFS 159
58039703   84 LIAVGLLVWTLTRTKRTLVAASCGAIAGGAIGNVIDRLRYGAVVDFLHAHAFGWSWYVFNIADSGIVCGVIVWLIDSLLA 163
162146415  87 LLIVLLLGVWVTRTTRPWVAGALGAIMGGAVGNVIDRMHYGAVVDFIHAHAYGWSWPVFNLADAAIDCGVAVLLFDSLTD 166
209543576  87 LLIVLLLGVWVTRTTRPWVAGALGAIMGGAVGNVIDRMHYGAVVDFIHAHAYGWSWPVFNLADAAIDCGVAVLLFDSLTD 166
258541834 161 GGQQQDNV 168
148259646 160 RDRAGHLP 167
58039703  164 ERQAAAK- 170
162146415 167 RRSRAPGA 174
209543576 167 RRSRAPGA 174
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap