Conserved Protein Domain Family
PRK14769

?
PRK14769: PRK14769 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173230
View PSSM: PRK14769
Aligned: 3 rows
Threshold Bit Score: 175.11
Threshold Setting Gi: 145223454
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145223454   1 MTRARITLAATAVIIAGLDLGLKAWAGRALNdGSSTDLGLLHLRLAFNPGVAFSLGDTLPPAVLLAVTGVIVVALAVFAY 80 
119716435   1 MRTGRVVVLLAAATVAGIDLTAKAVSEVQLA-NSSVDLGLLQLKLAHNSGVAFSMGDRLPVGVIVAITAAIAVTLAVYAW 79 
256826342   4 ARASRALVLLAALAAAAIDLGAKAASEAQLA-GSTVDLGVLRLRLAYNSGVAFGMGDELPVGVIVAVTAVICLALIAYAW 82 
145223454  81 RFTRTAALPVVLALAALLGGALANLIDRAADGLVTDYLHTGWFPTFNLADVFVVTGAAALALASWRASDTADTGAAT 157
119716435  80 RRAPHAGWVERIAGGAVIGGALANVVDRARDGVVTDYLHTGWWPTFNLADTFLVTGFVVIAVLHARPERTKETAAAP 156
256826342  83 RRAPDAGWVERIAGGAVIGGAVANVVDRARDGTVTDYLHTGWWPTFNLADTFLVTGFIVIALLHARPERTADQA--- 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap