Conserved Protein Domain Family
PRK14768

?
PRK14768: PRK14768 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173229
View PSSM: PRK14768
Aligned: 3 rows
Threshold Bit Score: 198.205
Threshold Setting Gi: 126700217
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126700217   1 MLYILIIILLIGLDQLSKIWVLNNLVDVSTIPIINNVFHLTYVENRGAAFGLLQNNQWIFIIVALLATVFGLYYLNTRKV 80 
260684171   1 MLYILIIILLIGLDQLSKIWVLNNLVDVSTIPIINNVFHLTYVENRGAAFGLLQNNQWIFIIVALLATVFGLYYLNTRKV 80 
260687830   1 MLYILIIILLIGLDQLSKIWVLNNLVDVSTIPIINNVFHLTYVENRGAAFGLLQNNQWIFIIVALLATVFGLYYLNTRKV 80 
126700217  81 HIFGRLGIILIISGALGNLIDRVRLGFVVDYFDFRIIWEYVFNIADVFVVVGTVFLCIYVLFFESKSR 148
260684171  81 HIFGRLGIILIISGALGNLIDRVRLGFVVDYFDFRVIWEYVFNVADVFVVVGTVFLCIYVLFFESKSR 148
260687830  81 HIFGRLGIILIISGALGNLIDRVRLGFVVDYFDFRVIWEYVFNVADVFVVVGTVFLCIYVLFFESKSR 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap