Conserved Protein Domain Family
PRK14766

?
PRK14766: PRK14766 
lipoprotein signal peptidase; Provisional
Statistics
?
PSSM-Id: 173227
View PSSM: PRK14766
Aligned: 3 rows
Threshold Bit Score: 288.306
Threshold Setting Gi: 42561114
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50365206   1 MFKNQISNLIFGLKSYDFKWKFKLIIATPIMSFLILLDWIIKWVVVATMKENDSKTFINGFLNIQYKINLGSAYGRgdYA 80 
42561114   2 WIKDKLVEAKVFLKNHNYLWKFKLIVCLPIFISLISFDWISKAIVVSHMKLGETKTFISGFLNFQYVINLGMAYGR--LQ 79 
83319849   2 WIKDKLVETKVFLKNHNYLWKFKLIVCLPIFISLISFDWITKAVVVSHMKLGETKTFISGFLNFQYVINLGMAYGR--LH 79 
50365206  81 DGLAKTVTLAALFVALLIIVFIFLNDKKWIITCSILLAGGFANLLARAWAPAtirDGQEIYGGVVDMFVWGFDFLGSSGY 160
42561114  80 DKAYLVIIFATIFSLFLTTIFIFLNNKKWLIVLIIILAGSWGNLLARLWAPG---NENNVYFGVVDFLTWDFSLLNSRDY 156
83319849  80 DKSYLVIIFATIFSLFLTIMFIFLNNKKWLVVLVIVLAGSWGNLLARLWAPG---NEDNLYYGVVDFLTWDFSLFNSRDY 156
50365206 161 IFNLADMWVNIGIGIGAVCFIIEMInIFKPKKQKEINKEVDKNENKS 207
42561114 157 VFNLADLYVNIAIGLTILFTIIELV-LYIKSKIKTKKEKIENEQNNS 202
83319849 157 VFNLADLYVNIAIGLTILFTIIELV-LYIKSKIKTKKEKIENEQNNS 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap