Conserved Protein Domain Family
PRK14752

?
PRK14752: PRK14752 
delta-lysin family phenol-soluble modulin
Statistics
?
PSSM-Id: 173213
View PSSM: PRK14752
Aligned: 15 rows
Threshold Bit Score: 52.6727
Threshold Setting Gi: 49486830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156980351  1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
57650707   1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
57867843   1 ------------------MAADIISTIGDLVKWIIDTVNKFKK- 25 
88195931   1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
87161319   1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
15925025   1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
15927610   1 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 44 
49484261   2 MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK 45 
148268488  1 ------------------MAQDIISTIGDLVKWIIDTVNKFTKK 26 
150394551  1 ------------------MAQDIISTIGDLVKWIIDTVNKFTKK 26 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap