Conserved Protein Domain Family
PRK14749

?
PRK14749: PRK14749 
cytochrome bd-II oxidase subunit CbdX
Statistics
?
PSSM-Id: 173210
View PSSM: PRK14749
Aligned: 15 rows
Threshold Bit Score: 34.1907
Threshold Setting Gi: 56413286
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
253773991  1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 
82776269   1 MWYLLWFIGILLMCSLSTLVLVWLDPRLKS 30 
74311536   1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 
62180357   1 MWYLLWFVGILLMCSLSTLVLVWLESRQQ- 29 
56413286   1 MWYLLWFVGILLMCSLSTLALVWLESRQQ- 29 
16765135   1 MWYLLWFVGILLMCSLSTLALVWLESRQQ- 29 
238900237  1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 
157160499  1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 
157158417  1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 
197362211  1 MWYLLWFVGILLMCSLSTLALVWLESRQQ- 29 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap