Conserved Protein Domain Family
gmk

?
PRK14737: gmk 
guanylate kinase; Provisional
Statistics
?
PSSM-Id: 173199
View PSSM: PRK14737
Aligned: 4 rows
Threshold Bit Score: 353.914
Threshold Setting Gi: 183220355
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116331215   1 MNSPKLFVLSSVAGGGKSTLIQKLREKHPDILFSISCTTRAPRPGDKEGVTYFFLTREEFKKGIKDSMFLEWALVHDQYY 80 
183220355   2 KAVPNLYIISSVAGGGKSTIIQALLKENPEFYFSISCTTRDPRPGDEEGKTYYFLTIPEFQKKIADGEFYEWAEVHGNYY 81 
189910470   2 KAVPNLYIISSVAGGGKSTIIQALLKENPEFYFSISCTTRDPRPGDEEGKTYYFLTIPEFQKKIADGEFYEWAEVHGNYY 81 
116328485   1 MNSPKLFVLSSVAGGGKSTLIQKLREKHPDILFSISCTTRAPRPGDKEGVTYFFLTREEFKKGIKDSMFLEWALVHDQYY 80 
116331215  81 GTPLKFIEEAFQKGSSVIMDIDVQGAKIIKEKFPGRiVTIFILPPSEKEWERRLRHRGTDSEESILKRIRNGKSELERQN 160
183220355  82 GTPKAPILDAIKEHRVALMDLDVQGAKSVKQLRPES-VTIFIEPPSREIWIERLIRRGTDSKTSIEKRIENGIIELDEAP 160
189910470  82 GTPKAPILDAIKEHRVALMDLDVQGAKSVKQLRPES-VTIFIEPPSREIWIERLIRRGTDSKTSIEKRIENGIIELDEAP 160
116328485  81 GTPLKFIEEAFQKGSSVIMDIDVQGAKIIKEKFPGRiVTIFILPPSEKEWERRLRHRGTDSEESILKRIRNGKSELERQN 160
116331215 161 EFDYKIVNDDLNQALADLERIILSKP 186
183220355 161 SFDYVVINDRLEDAITEVKAILCGTK 186
189910470 161 SFDYVVINDRLEDAITEVKAILCGTK 186
116328485 161 EFDYKIVNDDLNQALADLERIILSKP 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap