Conserved Protein Domain Family
atpC

?
PRK14736: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 173198
View PSSM: PRK14736
Aligned: 10 rows
Threshold Bit Score: 216.199
Threshold Setting Gi: 220924730
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
220927117   1 MATFQFDLVGPERVLYSGPVDAVQLPGSEGEMTVLPGHAPVLTTLKTGVLVITEGPQHGKRVLVRGGFAEINATGLTVIA 80 
220926659   1 MANLFAQLISPERVVFSGEVRSVLLPGVEGDMTVLPGHAPLVTLLHAGLVFATDAEGTGRRAFVRGGFAEVTGTQVTILA 80 
220924730   1 MAGLFAELVSPERIVFAGEVRSVLLPGVEGDMTVLPGHAPLVTMLHAGLVFATDAAGTGRRAVVRGGLVEVTGTRVTILA 80 
218529717   1 MATFHFDFVGPERTLYSGEVEAVQLPGSEGEMTVLPGHAPVLTTLKVGVITVTETTGNGMRIYVQGGFADIGPKSVTVLA 80 
188580720   1 MATFHFDFVGPERTLYSGEVEAVQLPGAEGEMTVLPGHAPVLTTLKVGVITVTETAGNGKRIYVQGGFADIGPTSVTVLA 80 
163850894   1 MATFHFDFVGPERTLYSGEVEAVQLPGSEGEMTVLPGHAPVLTTLKVGVITVTETTGNGMRIYVQGGFADIGPKSVTVLA 80 
170744667   1 MATFQFDLVGPERVIYSGAVDAVQLPGSEGEMTVLPGHAPVLTTLKTGVLVITEGPQHGKRVLVRGGFAEINATGLIVIA 80 
170747036   1 MATFHFDFVGPERTLYSGEVTAVQLPGTEGEMTVMPGHAPVLTSLRVGVIVITESQGSGKRIYVRGGFADIGPTAVTVLA 80 
240138024   1 MATFHFDFVGPERTLYSGEVEAVQLPGSEGEMTVLPGHAPVLTTLKVGVITVTETTGNGMRIYVQGGFADIGPKSVTVLA 80 
254560585   1 MATFHFDFVGPERTLYSGEVEAVQLPGSEGEMTVLPGHAPVLTTLKVGVITVTETTGNGMRIYVQGGFADIGPKSVTVLA 80 
220927117  81 ERATPVEELTSESIDAEIIAAETHRDATDDLDKRRDIDMAIAQLRESKEALKF 133
220926659  81 DHVLSVEELTRDRLDEEILHLQMERDGTADPDLRAQHEASIGRMEEFKASLGL 133
220924730  81 ERVLPVEELTRDQIDEEILYFQMERDGTANPERRAQCEVSIGRLEEFKANLRL 133
218529717  81 ERAAPIEEVTPGMIDREIEAVELVRDATQDLAKREALNAQIVQMQEAKNTLSR 133
188580720  81 ERAAPIEELTPAMIDKEIEAAELARDATQDLARREALNAQIVQMQEAKHTLSL 133
163850894  81 ERAAPIEEVTPGMIDREIEAVELVRDATQDLAKREALNAQIVQMQEAKNTLSR 133
170744667  81 ERATPVEELTPESIDAEIANVETLRDATDDLDKRRDFDMQIAQLRESKETLKF 133
170747036  81 ERAAPIEELTHESLDRDIEAVEMQRDATEDLQKREELNGQIVQLQETKALLKL 133
240138024  81 ERAAPIEEVTPGMIDREIEAVELVRDATQDLAKREALNAQIVQMQEAKNTLSR 133
254560585  81 ERAAPIEEVTPGMIDREIEAVELVRDATQDLAKREALNAQIVQMQEAKNTLSR 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap