Conserved Protein Domain Family
atpC

?
PRK14735: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 173197
View PSSM: PRK14735
Aligned: 6 rows
Threshold Bit Score: 210.625
Threshold Setting Gi: 219847905
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222526519   1 MPIHLEIVTAERVILSDDVDMISAPTKDGRVGILPRHAPLMTILEPGELDIIKNGERTPFAVSGGFMEVLPHRVTILADT 80 
156741250   1 MPIHLEIVTAERVVLSDDVDMINAPTKDGRVGILPRHAPLLTILEIGELDIVKDGVTTPFAISGGFMEVLPHRVTILADT 80 
159900586   1 MPIQLEIVTAERVVLSEEVDMVSAPSVEGRVGILPRHEPLLTVLQPGELHYVKNGVSMPYAISGGFMEVLPNRVTILADT 80 
163848584   1 MPIHLEIVTAERVILSDDVDMISAPTKDGRVGILPRHAPLMTILEPGELDIIKNGERTPFAVSGGFMEVLPHRVTILADT 80 
219847905   1 MPIHLEIVTAERVILSDDVDMISVPTKDGRVGILPRHAPLMTILEPGELDIIKNGERTPFAVSGGFMEVLPHRVTILADT 80 
148654680   1 MPIHLEIVTAERVVLSDDVDMINAPTKDGRVGILPRHAPLLTILEVGELDIVKDGVTTPFAISGGFMEVLPNRVTILADT 80 
222526519  81 VERADEIDEARAEQARAEAEARRREAQSERDMALAEAKLRKEMVRLRVAQLHKIKRRQS 139
156741250  81 AERADEIDEARAEAARRAAEQRIAERRSAQDLALAEAELRRALVQLKVAQLKKIRRERD 139
159900586  81 AERADEIDETRAEQARLQAEQAMRDRQSTEDLARAEIALRRATVRLQVAKLRRNRQ--- 136
163848584  81 VERADEIDEARAEQARAEAEARRREAQSERDMALAEAKLRKEMVRLRVAQLHKIKRRQS 139
219847905  81 VERADEIDEARAEQARAEAEARRREAQSEHDMALAEAKLRKEMVRLRVAQLHKIKRRQS 139
148654680  81 AERADEIDEARAEAARRAAEQRIAERKSAQDLALAEAELRRALVQLKVAQLKKIRRERD 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap