Conserved Protein Domain Family
coaE

?
PRK14733: coaE 
dephospho-CoA kinase; Provisional
Statistics
?
PSSM-Id: 173195
View PSSM: PRK14733
Aligned: 9 rows
Threshold Bit Score: 343.925
Threshold Setting Gi: 110670997
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187931236   1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
167627369   1 MSVIQTYPIGITGGIASGKSTATKILKEKMNLNVVCADTISREITKKPSVIKKIAEKFGNDVVMNKQINRAMLRAIITES 80 
156501694   1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
115314233   1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
118498067   1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
110670997   1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
134301830   1 MSFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
89255738    1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
56708526    1 MNFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITES 80 
187931236  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAIAF 160
167627369  81 KEAKKWLEDYLHPVINREIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLRKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
156501694  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
115314233  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
118498067  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
110670997  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
134301830  81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
89255738   81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
56708526   81 KEAKKWLEDYLHPVINKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAF 160
187931236 161 INLQISDKEREKVADFVIDNTELTYQELESKLITTINEITNLTN 204
167627369 161 INLQISDNEREKIADFIIDNTNLSDKELEDELIATINNITNLTN 204
156501694 161 INLQISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN 204
115314233 161 INLQISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN 204
118498067 161 INLQISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN 204
110670997 161 INLQISDKEREKIADFVIDNTELTNQELESKLITTINEITNLTN 204
134301830 161 INLQISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN 204
89255738  161 INLQISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN 204
56708526  161 INLQISDKEREKIADFVIDNTELTNQELESKLITTINEITNLTN 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap