Conserved Protein Domain Family
coaE

?
PRK14731: coaE 
dephospho-CoA kinase; Provisional
Statistics
?
PSSM-Id: 173193
View PSSM: PRK14731
Aligned: 11 rows
Threshold Bit Score: 339.324
Threshold Setting Gi: 193216073
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194334009   1 MNNRPLLVGVTGGLGSGKSTVCRILAEYGCEIFEADSVARQLQVTDPVIIEGIRRLFGNEVYQMRADGVLWLDRPAIARR 80 
194336609   2 MHSYPFLVGITGGLGSGKSMVCRFLSEMGCALFESDQVAKELQLHDPEVIEGIKALFGEKVYSLDLSGNLVLDRKTIAAV 81 
189346619   4 VRNYPFLVGVTGGIGSGKSTVCRFLAEMGCALFEADRVAKELQCSDPEIIAGIRDLFGGDVYAVGAGGVLLLDRRRIAGE 83 
189500397   7 AVSLPVLVGITGGLGSGKTTVCTMLEAMGCSVFEADRVARELQLNDPEVIEGIRRMFGEDVYSSDASGKLLLDRQRIAQQ 86 
193212802   1 MERLPLLVGVTGGIGSGKSTVCAMLVGMGCELFEADRVAKELQLQDPEVIAGIKALFGSEVYHCDDLGVLSIDRKLIASV 80 
193216073   3 LREAIHLVGVTGGIGCGKSEVCRILSSLGCKVFNADNVAKQIQEEDADVIAGMKKLFGDDIYHKNGTARLLPDRKKIAQI 82 
145219783   2 TSPAPFLVGVTGGIGSGKSTLCSFLARSGCEVFEADRVAKELQVTNAGVIEGMASLFGKDIYSKNESGALVLDRKRVARE 81 
119356812   1 MVVNPFLVGVTGGIGSGKSTLCRYLAELGCELFEADVVAKELQLDDSEVISGIKKLFGENVYGKDPEGNLFLDRRMIAGV 80 
78187084    2 TPSHPFLVGVTGGIGSGKSTLCRFLEKMGCELFEADKVARQLQVSDPEIMEGIKSLFGKDVYSKTRSGKLSLDRKRIARE 81 
78188933    2 ESKLPLLVGVTGGLGSGKSMVCRYLASMGCALFEADVVAKELQVRDSKVIEGITALFGKEVYSYNPKGELQLNRKDIAQV 81 
21674034    2 KARLPLLVGVTGGIGSGKSTVCAMLAEMGCELFEADRIAKELQVEDPEVIRGIEKLFGPDVYSRDASGKLLIDRKAIAAI 81 
194334009  81 VFADASLLQKLNRLIHPAVYSVFQSAVDDARRKGINVLVKEAAILFESGGDTLLDCIVVVTADRELRIQRALQRGGASRE 160
194336609  82 VFSSSDKLAALNRLVHPKVLAEFSRAVLDARRRRVKILVKEAAILFESGGNEGLDVVVVVAAELQDQIERAVLKGMGERE 161
189346619  84 VFSDSEKLLALNRLVHPKVYEAFHVAADRAARQGNTVLVKEAAILFETGKTAELDLVVVVAAGTELRVQRAVDKGMGSRE 163
189500397  87 VFKDPSTLKMLNELIHPKVFKAFRDAVHQAAGDGVRIFLKEAAILLESGGDKGLDILVVVASDLERRVQRAMKKGMGSRE 166
193212802  81 VFSDSRKLEALNRLIHPKVGEAFQREILRCAKEGKRILCKEAAILFESGMYHELDRIIVVAANDGLRLERAVERGMGTRE 160
193216073  83 VFSDEKKLQALNNLIHPKVFAAFERAKESVCETEKKVLVKEAAILFEAGGTKGLDEIVVVAADFDVRLERLKQAGMEE-S 161
145219783  82 VFSYPLKLGALNSLIHPEVRAEFMRFVQDARSRGKGIVILEAAILFESERSSDMDFIVVVAADEDIRLKRASARGRISVA 161
119356812  81 VFSDREKLDALNRLVHPKVFNAFDRALERARSNGSRLLVKEAAILFESGSSTALDFVVVVASGMEERVARAVAKGLGSRE 160
78187084   82 VFSHPATLGALNNLIHPKVYNAFRQRALEAFGRGTAILVMEAAILFETGRAADLDFVVVVAADTETRIKRAVTRGLGTPE 161
78188933   82 VFSNQEKLGALNRLIHPRVAVAFQQACDNAARSNVAILVKEAAILFESGAHAGLDVVVVVQAATELRVERAVQKGLGTRE 161
21674034   82 VFSEPEKLAALNRLIHPKVREAFVNEVKRCAREGKRILCKEAAILFEAGADRDLDRIIVVAANDGLRLARAVARGLAC-E 160
194334009 161 DIIRRINAQWPQEELVRRADYVIDNSGTFDQLKSRTRQVYELIVRDAL 208
194336609 162 GIVRRLATQWPQEKLIAKADYVLYNRGSLVELKKETEALFQVLLQAAE 209
189346619 164 DILVRIAAQWPQDKLIENAGYVIYNEGTLDDLHKETEKLYAFIVQRAL 211
189500397 167 EIQRRIEAQWPQEKLVERADYVIENNGSIEDLEIRVRALYQDILNQAA 214
193212802 161 EIKRRMKAQWPQEQLIKRAHYVIFNDGTLDELRAQVEQVYQSLESLVA 208
193216073 162 QIRSRMQSQWSQEELIKRADFVIYNNSSLESLKAQTESVLEKILA--- 206
145219783 162 DIKKRMAMQWPQELLIKKSDYVLWNNGGKDELKHAATELISVLKDAAE 209
119356812 161 EIFRRIGSQWPQEKLMEMADYVVCNNGSLEELRLKAVALYRYLLSLAE 208
78187084  162 DIRKRIALQWPQEMLVARADYVVNNDIGKTKLKEEAGRLYSVLVEAAA 209
78188933  162 EILRRLAVQWAPEKLAALADVVIDNNGTPEALYEKTKQLYEQLLQQAM 209
21674034  161 EARKRMQAQWPQEKLVERAHYVIFNDGTLDELRSQVEQVYQSLLTVVE 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap