Conserved Protein Domain Family
miaA

?
PRK14729: miaA 
tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Links
?
Statistics
?
PSSM-Id: 173191
View PSSM: PRK14729
Aligned: 8 rows
Threshold Bit Score: 540.979
Threshold Setting Gi: 51599072
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218249803   1 MKEDRVVFIFGPTAVGKSNILFHFPKNKAEIINVDSIQVYKEFNIASSKPSKNLMKHIKHHLVDFLDPEKDYTIGIFYEQ 80 
187918674   1 MKRNKIVFIFGPTAVGKSELLLNFPKGVAEIINVDSVQVYKEFDIASCKPSIELRAHVKHHLVDFLEPIEEYNLGIFYKE 80 
203284721   1 MKTNKIVFIFGPTAVGKSDILFHFPKGVAEVISVDSIQVYKEFDIASCKPSIELRSHIRHHLVDFLEPIYEYNLGIFYKE 80 
203288248   1 MKTNKIVFIFGPTAVGKSDILFHFPKGVAEVISVDSIQVYKEFDIASCKPSIELRSHIRHHLVDFLEPIYEYNLGIFYKE 80 
111115656   1 MKEDRIVFIFGPTAVGKSNILFHFPRNKAEIINVDSIQVYKEFNIASSKPGKSLMKHIKHHLVDFLEPEKEYTLGIFYEQ 80 
119953598   1 MKKNKIVFIFGPTAVGKSDILFNFPKGIAEVINVDSIQVYKEFDIASCKPSVELRSHIKHHLVDFLEPIEEYNLGVFYKE 80 
51599072    1 MKEDRIVFIFGPTAVGKSNILFHFPKNKAEIINVDSIQVYKEFNIASSKPSKNLMKHIKHHLVDFLDPEKEYTLGIFYEQ 80 
15595166    1 MKEDRVVFIFGPTAVGKSNILFHFPKNKAEIINVDSIQVYKEFNIASSKPSKNLMKHIKHHLVDFLDPEKDYTIGIFYEQ 80 
218249803  81 ALKIVKEIRQKKKIPIFVGGTAFYFKHLKDGFPSTPLVTSKIRIYVNNLLELKGKSYLLKELKNVDPIRFNMLNKNDIYR 160
187918674  81 ACEIIENLRVQKKLPVFVGGSAFYFKHLKYGLPSTPPVSSEIRLHINSLFTTRGKNYLLEELKRVDFERYESISKNDIYR 160
203284721  81 SCKIIESLREQKKIPIFVGGSAFYFKHLKYGLPSAPPVSEKVRLYINNLFIKMGKDYLLEELRRVDFKRYESINQNDIYR 160
203288248  81 SCKIIESLREQKKIPIFVGGSAFYFKHLKYGLPSAPPVSDKVRLYINNLFIRMGKDYLLEELRRVDFKRYESINQNDIYR 160
111115656  81 ALKIVKEIRQKKKIPIFVGGTAFYFKHLKDGFPSTPLVTSKIRIYVNNLLDLKGKSHLLKELKNVDPIRFNMLNKNDIYR 160
119953598  81 ASKIIKNLRDQDKLPVFVGGSAFYFKHLQYGLPSTPPVSSEIRFYVNSLFTTRGKDYLLEELKRVDFERYESISENDIYR 160
51599072   81 ALRIVKEIRQKKKIPIFVGGTAFYFKHLKDGFPSTPLVTSEIRIYVNNLLYLKGKSYLLKELKNVDPIRFNMLNKNDIYR 160
15595166   81 ALKIVKEIRQKKKIPIFVGGTAFYFKHLKDGFPSTPLVTSKIRIYVNNLLELKGKSYLLKELKNVDPIRFNMLNKNDIYR 160
218249803 161 IKRSLEVYYQTGIPISQFQKKQNSeFKNIVIIGLKRSFEDLKTRISIRINEMLNSGLLSEIKGLFSKGYNENTPAFKGIG 240
187918674 161 IKRSLEVYYQTGIPISQFLKRGQM-LANVLAIGLRRPMEEMRSRIISRVKNMIDCGLLEEIKSLLGKGYNETTPAFKGIG 239
203284721 161 IKRSLEVYYQTGIPISQFLQRENM-FENIVAIGLRRPMDEMKSRIISRVKNMIDCGLLDEIKSLLGKGYDEKTPAFKGIG 239
203288248 161 IKRSLEVYFQTGIPISQFLQRENM-FENIVAIGLRRPMDEMKSRIISRVKNMIDCGLLDEIKSLLGKGYDEKTPAFKGIG 239
111115656 161 IKRSLEVYYQTGIPISQFQKKQNSeFKNILIVGLKRSFEDLKTRISIRINEMLNSGLLSEIKGLFSKGYNENTPAFKGIG 240
119953598 161 IRRSLEVYYQTGIPISQFLKKGQM-IEDVLAIGLKRPMEEMRSRIISRVGNMIDCGLLEEIKSLLGKGYDETTPAFKGIG 239
51599072  161 IKRSLEVYYQTGIPISQFEKKQNSeFKNILIIGLKRSFEDLKTRISIRINEMLNSGLLSEIKGLFSKGYNENTPAFKGIG 240
15595166  161 IKRSLEVYYQTGIPISQFQKKQSSeFKNIVIIGLKRSFEDLKTRISIRINEMLNSGLLSEIKGLFSKGYNENTPAFKGIG 240
218249803 241 YNEFLLWKSRPCYGLNDIIGLINKNSFLYAKRQMTFFAKISDVLWLHPEDDLDNILNLIFK 301
187918674 240 YREFLLWKSRPYSMLNDIINLIVKNSFLYVKRQMTFFDKIPNVLWFHPDDDLKDILDLIFV 300
203284721 240 YREFLLWRSRPCYLLNDIINLIVKNSFLYVKRQMTFFNKLPNVLWFHPDDDLKNILDLIFV 300
203288248 240 YREFLLWRSRPCYLLNDIINLIVKNSFLYVKRQMTFFNKLPNVLWFHPDDDLKNILDLIFV 300
111115656 241 YNEFLLWKSRPWYSLNDIISLINKNSVLYAKRQMTFFAKMPDVLWFHPEDDLDDILNLIF- 300
119953598 240 YREFLLWKSRPYSMLNDIIDLIVKNSFLYVKRQMTFFDKIPNVLWFHPDDDLRDILDLIFV 300
51599072  241 YNEFLLWKSRPCYSLNDIISLINKNSFLYAKRQMTFFAKISNVLWFHPEDDLVSILNLIFN 301
15595166  241 YNEFLLWKSRPCYGLNDIIGLINKNSFLYAKRQMTFFAKISDVLWLHPEDDLDNILNLIFK 301
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap