Conserved Protein Domain Family
flhF

?
PRK14722: flhF 
flagellar biosynthesis regulator FlhF; Provisional
Statistics
?
PSSM-Id: 173185
View PSSM: PRK14722
Aligned: 3 rows
Threshold Bit Score: 779.673
Threshold Setting Gi: 53724310
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
53724310    1 MRNAARRLPADEPAAAKPALRLPEDTAAAVADAVKARIERIVNDTVMQELGSLRELMEEQFAGLMWNERQRRNPVHGALT 80 
121598247   1 MRNAARRLPADEPAAAKPALRLPEDTAAAVADAVKARIERIVNDTVMQELGSLRELMEEQFAGLMWNERQRRNPVHGALT 80 
124385699   1 MRNAARRLPADEPAAAKPALRLPEDTAAAVADAVKARIERIVNDTVMQELGSLRELMEEQFAGLMWNERQRRNPVHGALT 80 
53724310   81 KYLFAAGFSAQLVRMIVDNLPEGEGYDTLDAAADWAQSVLAANLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAAR 160
121598247  81 KYLFAAGFSAQLVRMIVDNLPEGEGYDTLDAAADWAQSVLAANLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAAR 160
124385699  81 KYLFAAGFSAQLVRMIVDNLPEGEGYDTLDAAADWAQSVLAANLPVLDSEDALMERGGVFALMGPTGVGKTTTTAKLAAR 160
53724310  161 CVMRFGASKVALLTTDSYRIGGHEQLRIFGKILGVPVHAVKDGGDLQLALAELRNKHMVLIDTIGMSQRDRTVSDQIAML 240
121598247 161 CVMRFGASKVALLTTDSYRIGGHEQLRIFGKILGVPVHAVKDGGDLQLALAELRNKHMVLIDTIGMSQRDRTVSDQIAML 240
124385699 161 CVMRFGASKVALLTTDSYRIGGHEQLRIFGKILGVPVHAVKDGGDLQLALAELRNKHMVLIDTIGMSQRDRTVSDQIAML 240
53724310  241 HGADTPVQRLLLLNATSHGDTLNEVVQAYRSAAGQPKAALPDLAGCILTKLDEASNLGGVLDTVIRYKLPVHYVSTGQKV 320
121598247 241 HGADTPVQRLLLLNATSHGDTLNEVVQAYRSAAGQPKAALPDLAGCILTKLDEASNLGGVLDTVIRYKLPVHYVSTGQKV 320
124385699 241 HGADTPVQRLLLLNATSHGDTLNEVVQAYRSAAGQPKAALPDLAGCILTKLDEASNLGGVLDTVIRYKLPVHYVSTGQKV 320
53724310  321 PENLYVATKKFLLKSAFCAPREDSPFVPHDDDLPAMLSALSTRTGNELHEVRFG 374
121598247 321 PENLYVATKKFLLKSAFCAPREDSPFVPHDDDLPAMLSALSTRTGNELHEVRFG 374
124385699 321 PENLYVATKKFLLKSAFCAPREDSPFVPHDDDLPAMLSALSTRTGNELHEVRFG 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap