Conserved Protein Domain Family
flhF

?
PRK14721: flhF 
flagellar biosynthesis regulator FlhF; Provisional
Statistics
?
PSSM-Id: 173184
View PSSM: PRK14721
Aligned: 4 rows
Threshold Bit Score: 722.892
Threshold Setting Gi: 134094537
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134094537   1 MNVRKFTASTSRGAWSLVREALGPDAVILSNRAVEGGVEILALAGEDMASLAEPMVEK-TISETTLAALAPRYQAQQAAQ 79 
114332397   1 MKVRKFLAATSHEVLRKVKEELGADAVILSNKQVPGGIEIMALAGKDISMLTSDTPHEaTAPSSVVKPTASPRHKPASGT 80 
152980692   1 MNVRKFTASTSRGAWSLVREALGPDAVILSNRAIDGGVEILALAGEDMASLAEPMVERaAISETTLASLVPHHK---PSQ 77 
30250408    1 MKVRKFLAATSHEVLRKVKDELGPDAVILSNKQVPGGIEIMALAGKDISSLTSDTPPEaTSP--AVKTTAAPRQKPASEK 78 
134094537  80 PAPPAIASRASLQTAASEINSAelhSVMSEIRSMRGMLEMQLAELAWTDQHKREPAKSSVLREMLAAGFSASLARYLTER 159
114332397  81 EQTATIHKQPETQPPAADSPGA---HIIQEIQAMRQMLEEQLTTMGWSNFSQRDPGGMKVLRTLLSAGFSPLLSRHLLEK 157
152980692  78 PAPLALTSNAAQSSDKVEISSAelnNMMSEIRSMRGMLEIQLSELAWNDPQKREPVKSTVLREMLAAGFSASLARYLIAR 157
30250408   79 KQAPPVQKQPAV----ADIQSA---NILQEIHAMRQLLEEQLITMGWSNFSQRDPGGMKVLRTLLSAGFSPLLSRHLLEK 151
134094537 160 MPAGASKQSGMDWIKAILTRNLATIGNEnEILEKGGVYALVGPTGVGKTTTTAKLAARCVMRHGPGKLALITTDGYRIGG 239
114332397 158 LPADRDFEQSLKKTISLLTLNLRTATGD-EIIEQGGVYALIGPTGVGKTTTTAKLAARAVIRHGADKVALLTTDSYRIGG 236
152980692 158 LPAGASNQSGMEWIKSILARNLATIGDEnEILEKGGVYALVGPTGVGKTTTTAKLAARCVMRHGPSKLALITTDGYRIGG 237
30250408  152 LPADRDFEQSLKKTIALLTLNLRTTAGD-EIIEQGGIYALIGPTGVGKTTTTAKLAARAVIRHGADKVALLTTDSYRIGG 230
134094537 240 YEQLRIYGKILGVMVHSVKDEADLRIALDELKGKHTVLIDTVGVSQRDNMVAEQIAMLSGAGSQVKRLLCLNATSTGETL 319
114332397 237 HEQLRIYGKLLGVSVRSIKDIEDLQLMLHELRGKHMVLIDTVGMSQRDQMLAEQIAMLSQCGTKIKHLLLLNATSSGDTL 316
152980692 238 YEQLRIYGKILGVMVHSVKDEADLRIALDELKGKHTVLIDTVGVSQRDQMVADQIAMLTGAGDQVKRLLCLNATSTGETL 317
30250408  231 HEQLRIYGKLLGISVRSIKDIDDLQLMLHELRGKHMVLIDTVGMSQRDQMLAEQITMLSQCGTEVKHLLLLNATSSGDTL 310
134094537 320 NEVARSYMGDGLAGCILTKLDEAATIGSALDVVIRQKLNLYYVANGQRVPEDLHVANQQYLVDRAFKLKRETAPFQFSDA 399
114332397 317 DEVISAYQKHSIHGCIITKVDESASLGIALDAIIRRKLVLHYVTNGQKVPEDLHEASSRYLLHRIFKPSPENSPFSLQDP 396
152980692 318 NEVVRSYMGDGLAGCILTKLDEAATIGSALDVVIRQKLNLYYVANGQRVPEDLHVANQQYLVDRAFKLKRETAPFQLGDA 397
30250408  311 DEVISAYQQHGIHGCIITKVDEAASLGIALDAVIRRKLVLHYVTNGQKVPEDLHEANSRYLLHRIFKPSAENSPFSLQDP 390
134094537 400 EIPLVMANTAKAMNDKSLREVILG 423
114332397 397 EFALIMASSAGDQPAIRQPERAEA 420
152980692 398 EIPAVMANTVRGMNDKSLREVILG 421
30250408  391 EFAMLMAGNYADQSVTRQQTRVEA 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap