Conserved Protein Domain Family
PRK14718

?
PRK14718: PRK14718 
ribonuclease III; Provisional
Statistics
?
PSSM-Id: 173181
View PSSM: PRK14718
Aligned: 10 rows
Threshold Bit Score: 701.553
Threshold Setting Gi: 161723174
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237813195   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
161723174   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFSKLDEGDLSRVRANLVKQQSLYE 80 
53720035    1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
53725351    1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
76811515    1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
126438815   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
126450086   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
126454458   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
121599423   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
124385463   1 MPLSQLESRLRYEFRNAELLRQALTHRSHSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEGDLSRVRANLVKQQSLYE 80 
237813195  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
161723174  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
53720035   81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
53725351   81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
76811515   81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
126438815  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
126450086  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
126454458  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
121599423  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
124385463  81 IAQALNISDGLRLGEGELRSGGFRRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILDHIDPRTLGKDAKTLLQEY 160
237813195 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
161723174 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVMAVAPMLAAKPKRSKSARGA 240
53720035  161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
53725351  161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
76811515  161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
126438815 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLATKPKRSKSARGA 240
126450086 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
126454458 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
121599423 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
124385463 161 LQGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKKALDEVTAVAPMLAAKPKRSKSARGA 240
237813195 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
161723174 241 KHMEPEIVPGVKGVQEALDLRSPDRKERGAGRTAGGEAKGVEPKAadvratVDAKSGDAKQGEPKVAESRVDDSRATEAR 320
53720035  241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
53725351  241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
76811515  241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
126438815 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
126450086 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
126454458 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
121599423 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
124385463 241 KHVEPEIVPGVKGVQEALDLRSPERKERGANRVAGGEAKGVESKA------VDAKHGESRAAQLRADDAKAGETKAGEAR 314
237813195 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTPVAVIRAAHVEHGLDKGEPRASKPAEKPAAATDKppekasdkpSPE 393
161723174 321 ASADAKAGAQTHAAVSPVVPAHADDsAARSPGTAPVAMIRAAHVEHGADKGEPRAAKPAEKPAPATDR---------LQE 391
53720035  315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTPVAVIRAAHVEHSLDKGEPRASKPAEKPAAATDKppekasdkpSPE 393
53725351  315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTSVAVIRAAHVEHGLDKGEPRASKPAEKTAAATDKppekasdkpSPE 393
76811515  315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTPVAVIRAAHVEHGLDKGEPRASKPAEKPAAATDKppekasdkpSPE 393
126438815 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTPVAVIRAAHVEHGLDKGEPRASKPAEKPAAATDKppekasdkpSPE 393
126450086 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTSVAVIRAAHVEHGLDKGEPRASKPAEKTAAATDKppekasdkpSPE 393
126454458 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTPVAVIRAAHVEHGLDKGEPRASKPAEKTAAATDKppekasdkpSPE 393
121599423 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTSVAVIRAAHVEHGLDKGEPRASKPAEKTAAATDKppekasdkpSPE 393
124385463 315 ASADAKAGAHTHAAAMPAVPEQADD-AARSPATTSVAVIRAAHVEHGLDKGEPRASKPAEKTAAATDKppekasdkpSPE 393
237813195 394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
161723174 392 KSAEKAPDKGHEKPQDKSPDPAPEKTPDKTAepltEKPDAAARVCAGAADRPPRARDASSAAEPDLAAAPVRVADAGH 469
53720035  394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
53725351  394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
76811515  394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSPAEPDLAAAPVRVADAGH 467
126438815 394 KMSEKTPDKSHEKQLNKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSPAEPDLAAAPVRVADAGH 467
126450086 394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
126454458 394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
121599423 394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
124385463 394 KTSEKTPDKSHEKQLDKSSEPVAEKALDKTA----DKPDAAARLPAETADRPPRARDASSSAEPDLAAAPVRVADAGH 467
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap