Conserved Protein Domain Family
ureE

?
PRK14711: ureE 
urease accessory protein UreE; Provisional
Statistics
?
PSSM-Id: 173174
View PSSM: PRK14711
Aligned: 9 rows
Threshold Bit Score: 370.899
Threshold Setting Gi: 189024488
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189024488   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
163843617   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
161619304   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVAHV 80 
225852842   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
148560047   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
62290255    1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
17986929    1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
23502231    1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVAHV 80 
256369775   1 MIIIEGIVGNSHDPQWRDRLADAKIDWLVLDQWEAQKSRLRKATSGDVELALSLDRNTHLHDGDILLWNEGDKCAVVARV 80 
189024488  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYGSCPARTLS 160
163843617  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
161619304  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
225852842  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
148560047  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
62290255   81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYGSCPARTLS 160
17986929   81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
23502231   81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
256369775  81 HLKEVMVIDLASVIGEDGNAIVRTVFELGHALGNQHWPAVVKETKVFVPLTVDRKVMASVMKTHNLPGVTYEFMPGADVI 160
189024488 161 P-IWPRTKRGVFSAEriPSAIAWSSARAGASSP 192
163843617 161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
161619304 161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
225852842 161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
148560047 161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
62290255  161 P-IWPRTKRGVFSAEriPSAIAWSSARAGASSP 192
17986929  161 PyMAPHEARRLFGGA--DSMLQSHDHQHGQEHH 191
23502231  161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
256369775 161 PyMAPHEARRLFGGA--DSMLQSHGHQHGQEHH 191
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap