Conserved Protein Domain Family
PRK14710

?
PRK14710: PRK14710 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173173
View PSSM: PRK14710
Aligned: 9 rows
Threshold Bit Score: 113.55
Threshold Setting Gi: 254791690
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82542993    1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFSHVAVDISIYTNVEDDY 80 
218693964   1 MLAISSNISKMVIFIFAIIIVVFLCVTTYLYLHKDESLVSKHYINYMAIPESDGVFTWLPDFFPHVAVDISISTNVEDDY 80 
253774510   1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
254160569   1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
254791690   1 MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
260866658   1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
260842697   1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
291281410   1 MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
209917718   1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDY 80 
82542993   81 FFSYFS 86 
218693964  81 FFSYFS 86 
253774510  81 FFLIFP 86 
254160569  81 FFLIFP 86 
254791690  81 FFLIFP 86 
260866658  81 FFLIFP 86 
260842697  81 FFSYFS 86 
291281410  81 FFLIFP 86 
209917718  81 FFSYFS 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap