Conserved Protein Domain Family
PRK14709

?
PRK14709: PRK14709 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173172
View PSSM: PRK14709
Aligned: 11 rows
Threshold Bit Score: 676.819
Threshold Setting Gi: 116689345
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116689345   1 MSAADTLGRPEDARPEREAASALEADarmfDELrraflakgngtnghaakpkhprgkdgrmtapldaiparlsgeiaatv 80 
170751547   2 AAGAEDIHRLFEFEQRNRSREKPKSN----GDL----------------------------------------------- 30 
170739471   1 MSGSESRIISLAEKQAKLREAATSSD----EDL----------------------------------------------- 29 
169825390   1 ----------MTANVRPIRRPAPPDN----DPV----------------------------------------------- 19 
220920024  13 RKAAEASYDFGCDEPEMKAPEAPSSAppprNDI----------------------------------------------- 45 
218529937  16 PESENRWSRDGNDEPEPKRKLKLDHN----GEP----------------------------------------------- 44 
27383368    7 TDASNSTVEARDEEPVAANDNKPASNp---GTS----------------------------------------------- 36 
107022397   1 MSAADTLGRPEDARPEREAASALEADarmfDELrraflakgngtnghaakpkhprgkdgrmtapldaiparlsgeiaatv 80 
146277397   3 NDPFENVAPIGGGSHGAKKKRKPKPPsrlpDDV----------------------------------------------- 35 
154247365   1 ---------MEHAAFETRRLTPDDVAdyrcNDL----------------------------------------------- 24 
258543726   1 ------------------MTGAINADkavqDGLrkaqttl----------------------------------gsnnya 28 
116689345  81 eLSEDAVAVVFASAYQGRLLFETLRGKWFRWE--DTHWKQDEgARVTREMIRRTVRKMCRGEPRWL-----TARVVDAIE 153
170751547  31 -LTEDWAARTFAERRVGDLLFCHDTGKWHTWT--GAAWRPNR-CGLAFQWARELAREMCENEEPKTrfiasKTAFAAGVE 106
170739471  30 -ITEDGVALEFAKQFEGFLRYNVDSKTWLHWT--GTIWETDK-VKRAFQYARELARRVAQEAPGHLrvthsKVAFAANVE 105
169825390  20 -LTESSIAALVVERFRDQLLYDHGQALWFEWA--GTCWVPDT-TGGVFDRCHTVVQEQMRLLSPKKqvrlgTAKFVSGVE 95 
220920024  46 -VTEDSAACEFAEIHGERLRYCHDTGSWYEWT--GVAWRQNR-VGMAFQWARELVRQLIANESPKArylasKTSFAAGVE 121
218529937  45 -LNQDSAAQAFAQRYAGRLLYCHDSAKWYEWT--GVAWKPNR-CGIAFHWSRELIRELFAEKSDRTryiasKVEFAGGIE 120
27383368   37 -VTEDSVAYIFASTYRDTLRFCHSTGAWFEWD--GSYWRRNE-VGLAAHHVRVMARDMSQGLSPKAlatirKRSFASGVE 112
107022397  81 eLSEDAVAVVFASAYQGRLLFETLRGKWFRWE--DTHWKQDEgARVTREMIRRTVRKMCRGEPRWL-----TARVVDAIE 153
146277397  36 -LTEDAVALMFTAQYGQRARFDHEMGRWVMWEpdALFWKQDR-VQLAAHWCRDLARDASMGNAPKVlervrRKSFLGGVE 113
154247365  25 -LTEDNAAARFTELFADKLRFCHDTGAWFEWT--GAAWQRNR-TGLAFNWARNLARDLAESEPDKVryvtgKTSFATGVE 100
258543726  29 lLTEHGMAAAFTERYKDELRYDHKAGCWFLWT--GTHWQEDC-KHRAFSYARMLVAEANQLCEQKEqaitgKASFCGGVE 105
116689345 154 KLARTDER-TCPSEPFDANPWLLATPAGVVDLRDGSSRAARPEDMMTRVTGCAPDFGGDCPRWRAFLGACIHGfdeygep 232
170751547 107 RFSRSDPVfAVTIEGWDADPWLLGTPGGTVDLRTGKLREADRADRITKLTAVAPAETPECPTWLKFLDDVTQG------- 179
170739471 106 TFAKTDPRlVTVYEDWDLDPYLLGTPGGTIDLRTGELRPALQSDMITRTTAVAPADTAECPQFLQFLDETFGG------- 178
169825390  96 KLCRHARTfVAQSEDWDGDPMVLGTPGGVVDLTTGKMRRAEPGDRITKQTAVAPADTADCPRFLRFLNEATGS------- 168
220920024 122 KFCRHDRTfAVTAETWDADRWLLGTPGGTVDLRTGRLREADQGERITKLTAVAPARLPDCPLWLAFLTQATGG------- 194
218529937 121 KYCRHDPAlAVTIEGWDADPWLLGTPGGTVDLRTGELRKAHREERVTKLTAVAPAEASGCPTWLRFLDDVTQG------- 193
27383368  113 GFARNDPTfAVTIEAWDRDPFLLGTPDGTVDLRTGKMRAADPADGITKLTSTAPSAQADCPLWLRFLQDATGG------- 185
107022397 154 KLARTDER-TCPSEPFDANPWLLATPAGVVDLRDGSSRAARPEDMMTRVTGCAPDFGGDCPRWRAFLGACIHGfdeygep 232
146277397 114 AMCRADPVhAVTHEVWDPDPMLLGCPGVTVDLRTGKMRAPIPEDMITRQAAVAPDPDADCPNWKSFIRSVTRE------- 186
154247365 101 KFARTDPAfAVTMDAWDRDPFMLGTPGGTVDLRTGILRPADPADGITKLAGCTPAAEAMCRRWLQFLEEATGG------- 173
258543726 106 RFARTDPAhAVVPEDWDKDPYLLATPGGTVDLRTGALRPACPADMITRVAAVAPSDMP-YPQWERFLNEATNG------- 177
116689345 233 rsappGDEMVRFLQRMCGYFLTGSTRFEFVFLLFGGGANGKSTFLRVLREILGDYFVSVAVETFLQSAHDQHPTGMAHIE 312
170751547 180 -----DAGYIRFLQQWAGYCLTGDTSEQALCFAYGGGGNGKGVLIHVLAGILADYAVNAAMETFTAAKHDRHPTEIAALR 254
170739471 179 -----DTETVRFLQQWCGYCLTGDTTEQRFVFGEGKGGNGKGVLIGTALGILKDYATVVAMEALTAAKHDRHPTEIAALR 253
169825390 169 -----DLGLMRFLQQWAGYSLTGRTTEHAVVFVFGGGGNGKSVYLKVLATALASYAATATMDAFVASKHAQHTTDLAMLK 243
220920024 195 -----DEGLTRFLRQWCGYALTGTVSEHALVFVYGPGGNGKSVFLNVLTGILAEYAKTAAMDTFTASKGDRHPTDMAMLR 269
218529937 194 -----DAGYIRFLQQWAGYCLTGDTSEQVLCFAFGGGGNGKGVLIHVLAGILKDYAVNAAMETFTASKHDRHPTEIAALR 268
27383368  186 -----DGEMIRFLQQWCGYCLTGDTREHALVFVHGDGGNGKSVFLNTTSYILHDYATTASMDTFVASRSDRHPTDLAMLR 260
107022397 233 rsappGDEMVRFLQRMCGYFLTGSTRFEFVFLLFGGGANGKSTFLRVLREILGDYFVSVAVETFLQSAHDQHPTGMAHIE 312
146277397 187 -----DDDLERFLQAFLGYSLTGSIKEHQMLFIHGNGGNGKSLLLSTVMGIMGDYAQMASMDTFASSRYERHSTDLAAMR 261
154247365 174 -----DAEAIRFMQQWCGYSLTGDTREHALIFVYGPGGNGKSVFLNVLTAIMADYATTAAMDTFTASHNDKHPTDLAMLR 248
258543726 178 -----DTELIVFLKRWCGYCLTGDTREHALLFGYGPGGNGKSVFLNTLSRIMGDYATVAAMDTFTASHGDRHSTDLAMLR 252
116689345 313 GARLAACGELPDNRSWNSQRVKDISSGEKISARHMRQDFYDFVPVCKLLFVGNHRPRVRQTGEAEKRRFRIIPFVHKvpE 392
170751547 255 GARLVTASETEQGRQWAEARIKQLTGGDTMRARYMRQDEFEFTPVLKLLIIGNNKPGLSSVDDAARRRFNLLPFLFK--P 332
170739471 254 GKRLVTASETEGGREWAEARIKALTGGDRIKARFMRQDEFEFLPQFKLFVMGNNRPSLRNVDQAMRRRLIVVPFNNDvpK 333
169825390 244 GARFVSASETQEGRAWDEARLKSFTGGDAITARFMHRDNMTFVPTCKITIVGNHKPKIRTVDEAMRRRLNIVPFIRK--P 321
220920024 270 GARLVTASETEEGRPWAEAKIKQLTGGDPVTARFMRQDFFTFTPTFKLTIVGNHQPLLRNVDDAARRRFNIVPFTRK--P 347
218529937 269 GARLVTASETEQGRQWAEARIKQLTGGDTMRARYMRQDEFEFTPVLKLLIIGNNKPGLSNVDDAARRRFNLLPFLFK--P 346
27383368  261 GARLVSASETEEGRAWAESRIKQMTGGDAISARFMRQDFFTFQPQFKLFVVGNHQPALHSVDAAARRRFNIVPFTRK--P 338
107022397 313 GARLAACGELPDNRSWNSQRVKDISSGEKISARHMRQDFYDFVPVCKLLFVGNHRPRVRQTGEAEKRRFRIIPFVHKvpE 392
146277397 262 GARVVGVSEVSQGVGWNQQRLAQMTGGDRVRARFMRQDEFEYHPQFKLIVVGNHKPELSHVNEAMRRRMNIVPFTWK--P 339
154247365 249 GARLVTASETEEGRAWAESRIKQMTGGDTITARFMRQDFFSFRPNFKLTIVGNHKPALRNVDDAARRRFNIVPFTRK--P 326
258543726 253 GARLVTASETEEGRAWAESRIKQMTGGDPITARFMRQDNFTFQPQFKLTIVGNHKPVLKNVDEAARRRFNIVPFIHK--P 330
116689345 393 NRRDSTLEDALREEYPAILAWMLDGAKAVIAEGFASmPGAVTKATNDYFAENDTFALWAGERLLLHKDYSVPAGVAYANY 472
170751547 333 AVPDPQLEEKLRKEWPQILRWMIEGCLDWQAHRLVR-PEVVKDATDEYFEQQDTFGQWLDARCIVDKGNPYRKATTQELF 411
170739471 334 EKRDPDLPKKLEAEWPGILRWMIDGCLDWQANRLIS-PKAVEDNTEEYFSGQDLLGQFLAEKCDLDPGNDRLTVGSTELY 412
169825390 322 AEPDPDLERKLLAELPGILRWPIDGCLDWQEHGLIR-PDAVLAATDEYLADEDLFGQWVEDRCKVDPGNRQMRTPNQDLY 400
220920024 348 ERPDPHLEAKLRAEWPAILRWMIEGCLDWQQNGLVR-PASVTEATEAYFAEQDLLGQWIADECVVRQGDPHCWDRIADLY 426
218529937 347 AVPDPRLEEKLRAEWPAILRWMIEGCLDWQANRLVR-PDVVKVVTDEYFSAQDTFSLWLEERCVVDRANPYRKATTQDLF 425
27383368  339 TKPDRELEAKLRGEAPAILRWMVDGCRDWQRNGLVR-PASIVEATETYFAEQDTFGQWLKDACRVEPDNRSISDFVADLF 417
107022397 393 NRRDSTLEDALREEYPAILAWMLDGAKAVIAEGFASmPGAVTKATNDYFAENDTFALWAGERLLLHKDYSVPAGVAYANY 472
146277397 340 EVPDQELALKLEPEWPAILQWLIRGCLEWQEHGLRK-PQVICRETEEYFEEQDTFAQWLEECCIVDRRDKNCWDVLVDLY 418
154247365 327 ATPDPELEAKLKEEWPGILRWMIEGCLDWQKNGLVR-PASVTEATQTYFSDQDLLGQWIEEMCRVERERPDMWDRRADLF 405
258543726 331 KNPDKDLESKLQGEWPGIMYWMIQGCLEWQREGMPR-PAVVKEATAEYFEAQDTFGQWLAERCILDPSLETKPNMLLKDF 409
116689345 473 TRWFEGGGYEGRPVSS-REFKMRMEDMGATHDRDN------RGRLYRGAKLDTSGDLSGES 526
170751547 412 ASWADFARGSNELVGTmHSFGDRLDKLGFKKNKNVptgvngRARGYEGIEVRPLPTREFES 472
170739471 413 NAWKSYALVNGEEAEAqKVFSPKIAGRGFPQIRGA------TGRGFSGIRLKPCPDFPLNA 467
169825390 401 ASWCDFAERVGARHGTlHELGEKLSKLGLARYKSG------GVRGFEGIYVTSTGA----- 450
220920024 427 ASWCEYARAAGDEPGTvKAFGPAMRRKGFQDKRTN------QAKGFAGIRVKVTPSYGHGD 481
218529937 426 ASWTEFARLNNEPPGTlTSFGERMEKLGFKKNKHVptvvgsRARGFEGIEVRPFPSRDAG- 485
27383368  418 KSWTDYAEASGERPGSqKGFVQSLTKSGFKKGQRVr-----GGQLYIGLQLLRQAEKEPSV 473
107022397 473 TRWFEGGGYEGRPVSS-REFKMRMEDMGATHDRDN------RGRLYRGAKLDTSGDLSGES 526
146277397 419 HSWKTFAEARLEPAGTaKTFGERLGECGFETAFKKia--gkSARVRLGVQLRRL------- 470
154247365 406 ESWTEYARGAGEDAGSaKSFYEAMLRKGFEPIRKH------SGRGFKGIQLLPKAHSAMGR 460
258543726 410 QEWCRNNGEPESDNKRmRGMLEKTEGVRYHRHKKL-------GQSVRGIGLRPHLHEAQRW 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap