Conserved Protein Domain Family
PRK14708

?
PRK14708: PRK14708 
flagellin; Provisional
Statistics
?
PSSM-Id: 173171
View PSSM: PRK14708
Aligned: 11 rows
Threshold Bit Score: 1098.42
Threshold Setting Gi: 115523542
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115526488  23 MSGIVLSNAVRQNLSSLQATAELLATTQSRLSSGKKVNSALDNPTNFFTAASLDSRSSDINNLLDGIGNGVQILQSANTG 102 
86750923    1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNSALDNPTNFFTAASLDARASDINNLLDGISSGVQILQAANTG 80  
86750909    1 MSDVVLSAAVRQNLLSLQSTADLLSTTQNRLASGKKVNTALDNPTNFFTAAGLDSRASDINNLLDGISNGVQILQAANTG 80  
115523544   1 MSNVVLSASVRQNLLSLQSTADLLATTQNRLASGKKVNSALDNPTNFFTAAGLDSRSSDINNLLDGISNGVQILQAANTG 80  
115523542   1 -MSVVLSNAVRQNLSSLQATAEMLATTQSRLSSGKKVNTALDNPTNFFTAASLDARASDINNLLDGIGNGVQILQAANTG 79  
39936990    1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNTALDNPTNFFTAASLDSRASDINNLLDGIGNGVQILQAANTG 80  
39936976    1 MADVVLSAAVRQNLLSLQSTADLLATTQNRLASGKKVNTALDNPTNFFTAAGLDSRASDINNLLDGIGNGVQILQAANTG 80  
39935366   44 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNTALDNPTNFFTAASLDSRASDINNLLDGIGNGVQILQAANTG 123 
192292818   1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNTALDNPTNFFTAASLDSRASDINNLLDGIGNGVQILQAANTG 80  
192292804   1 MADVVLSAAVRQNLLSLQSTADLLATTQNRLASGKKVNTALDNPTNFFTAAGLDSRASDINNLLDGIGNGVQILQAANTG 80  
192290923   1 MSGIVLSNAVRQNLSSLQATADLLATTQSRLSSGKKVNTALDNPTNFFTAASLDSRASDINNLLDGIGNGVQILQAANTG 80  
115526488 103 ITSLNKLVDSAKSIANQALQTVAGYATKSNVSATISGATADDLRGTQSFSNAVASSNVVFDGSSGGATTASGSDLLGGVA 182 
86750923   81 ITSLTKLVDSAKSIANQALQTTSGYATKSNVSATISGATAEDIRGTQSFDNAVATGNVIFDGTTGGTTAAAGTDTLGGAI 160 
86750909   81 ITSLNKLIDTAKSIANQALQSNVGYSTKSNVSATIAGATPDDLRGTQTFASATATSNVVYDGTAGGTNGVSLTDTLGGGV 160 
115523544  81 ITSLNKLIDTAKSIASQALQSNVGYTKKSNVAATIAGATPEDLRGTQTFASATATSNVIYDGTLGGTSTVLPLTTLGGGV 160 
115523542  80 ITSLNKLVDSAKSIANQALQTTSGYATKSNVSTTIAGATSEDLRGTQSFSNATATSNVIFDGTTGGATAASGTDSLGGAI 159 
39936990   81 ITSLNKLVDSAKSIANQALQTTSGYATKSNVSATISGATADDLRGTQSYSNAVATGNVIFDGTAGGSTAASGTDTLGGAI 160 
39936976   81 ITSLNKLIDTAKSIANQALQSNVGYSTKSNVAATIAGATPNDLRGTQTFASAIATSNVIYDGTAGGTSGVSLTDTLGGGI 160 
39935366  124 ITSLNKLVDSAKSIANQALQTVAGYASKSNVSATISGATADDLRGTQSFSNAVASSNVVFDGTAGGASTASATDLLGGIA 203 
192292818  81 ITSLNKLVDSAKSIANQALQTTSGYATKSNVSATISGATADDLRGTQSYSNAVATGNVIFDGTAGGSTAASGTDTLGGAI 160 
192292804  81 ITSLNKLIDTAKSIANQALQSNVGYSTKSNVAATIAGATPNDLRGTQTFASAIATSNVIYDGTAGGTSGVSLTDTLGGGI 160 
192290923  81 ITSLNKLVDSAKSIANQALQTVAGYASKSNVSATISGATADDLRGTQSFSNAVASSNVVFDGTAGGASTASATDLLGGIA 160 
115526488 183 VSIA--ASAAKTVVGAADNTALGSALTVGTASGAATNTSKISELTNGLTATATGPASGDAITVNGKTITFTTAGVAKADS 260 
86750923  161 VSIA--ASAAVTVLGAVDATATGAVLSVGTAAATAAGTNLISELTNGSTVTATGPAAGDSITVNGKTITFTTAGASSKDS 238 
86750909  161 GSIT---GTNITKAVAADATATGGVLYTGTATATATSADLISSLTNGSTVTPTGPQAGDIIVVNGKNITFTTTGSATADS 237 
115523544 161 GTIP--GGVVASGSAADATAVAANTISVGTAAATATAADLISSLTNGATPTATGPQIGDILVVDGKTITFDGTSSSTPDG 238 
115523542 160 VSIAtpAASSVQVAIAADASVSGSALSVGTAAATAAGGTLLSALTSGASATATGPVAGDSITVNGKTITFVTAGAANKDT 239 
39936990  161 VSIA--AGTAVTALGAADNTALGSVLSVGTAAATAGGSNLISDLTNGSTTTATGPAAGDSITVNGKTITFTTAGAASKDS 238 
39936976  161 GSLV---GTAVTKNVPTDATSTGAVLYTGTATATATGTDLISSLTNGSTTTPTGPQAGDVLVVDGKTITFTATGTPTVDS 237 
39935366  204 VSIA--ASAAVTVVGAADNTGLGSALTIGTSGGSATGASKISDLTNGVTATATGPASGDAITVNGKTITFTTAGTAKADS 281 
192292818 161 VSIA--AGTAVTALGAADNTALGSVLSVGTAAATAGGSNLISDLTNGSTTTATGPAAGDSITVNGKTITFTTAGAASKDS 238 
192292804 161 GSLV---GTAVTKNVPTDATSTGSVLYTGTATATATGTDLISSLTNGSTTTPTGPQAGDVLVVDGKTITFTATGTPTIDS 237 
192290923 161 VSIA--ASAAVTVVGAADNTGLGSALTIGTSGGSATGASKISDLTNGVTATATGPASGDAITVNGKTITFTTAGTAKADS 238 
115526488 261 EGNYTIGLDQDLAALTKTIDAMNNNTTNPSIVTG-GKLELHSGTNSPLTISDNAGGAVLAKLGLGkqtdptnFKVDTAAA 339 
86750923  239 SGNYTIGLDQTVNSLLDTIDTVNGNTGLSSAVTA-GRLELHSGTNSPLTVGDNAGGAVLAKLGLT-------AQTVDTAA 310 
86750909  238 NGNYTIGINQPISALLASIDTINGNTSNPSVVDAnGHIQLHTGTNRSLSISDTSSGTVLAKLGFG-------STVTVPLG 310 
115523544 239 NGNYTIGINQTISSLLATIDAINGNVPPTSTMTG-GKIVLHSGTNRSLAVSDMTGGGVMSKLGLA-------ASVTVPLG 310 
115523542 240 EGNYTFGLDQTLTSLANTIDTMNNNTTNASVITA-GALVLHTGVNSPLTIGDNGNGT-LAKLGL--------VAGTTNTG 309 
39936990  239 NGNYTIGLDQTLTKLANTIDDINGNTGHSSTITA-GKLELHSGTNSPLTIGDNAGGAVLAKLGLT-------AQTVDTAA 310 
39936976  238 NGNYTIGVNQPINALLATVDTINGNTSNPSVVNSsGHLELHTGTNRALSVSDTSGGTVLAKLGFS-------APVSTSLG 310 
39935366  282 EGNYTIGLDQDLTALTKTIDAMNNNTTNASAVTA-GKLELHSGTTSPLTISDNAGGAVLAKLGLGgs---tqFKVDTAAA 357 
192292818 239 NGNYTIGLDQTLTKLANTIDDINGNTGHSSTITA-GKLELHSGTNSPLTIGDNAGGAVLAKLGLT-------AQTVDTAA 310 
192292804 238 NGNYTIGVNQPINALLATVDTINGNTSNPSVVNSsGHLELHTGTNRALSVSDTSGGTVLAKLGFS-------APVSTSLG 310 
192290923 239 EGNYTIGLDQDLTALTKTIDAMNNNTTNASAVTA-GKLELHSGTTSPLTISDNAGGAVLAKLGLGgs---tqFKVDTAAA 314 
115526488 340 TSPAANISGSTQLFNSNGGLSSTAIADGTTLSVNGKTITFKTSDAPQGNNIATGTGVLGRIGTDGNGNSTIYLGNQSNFT 419 
86750923  311 ATASANISASTQLFNTHGGLTTTAIADGTTLSVNGKTITFKTADAPQGNNIPTGTGVLGRIGTDGNGNSTIYLGDQTKFT 390 
86750909  311 TGAATAITATTKLFNSVGGLG-PAIADGTTLTVNGKSVTFKASDPPSAAGLLAGSGVLGNIVTDTAGNSTIYMGTSNTYT 389 
115523544 311 A-AGGNMTTNTKLFNTVGGLSTTPIADGTTLTVNGKTVTFKASDPPTPAGLLAGSGVLGNIVTDSSNNSTIYLGTSNTYT 389 
115523542 310 AGAAANISATTQLFNTNGGLTTSSIADGTTLSVNGKSITFKTADAPSASAMPEGSGVLGKVATDGNGNSTIYLGNQTNFT 389 
39936990  311 ATASANISATTQLFNTHGGLTTAAIADGTQLTVNGKTITFKTSDAPQGNNIPTGTGVLGRIGTDGNGNSTIYLGDQTKFS 390 
39936976  311 TGASAPITASTKLFNTVGGLG-AAIADGTTLTVNGKTITFKASDPPSPAGLLVGSGVLGNIVADSQGNSTIYLGTSNTFT 389 
39935366  358 TTAAGNISGATQLFNSHGGLSSTAIADGTTLSVNGKTITFKTSDAPQGNNIASGTGVLGRIGTDGNGNSTIYLGNQSNFT 437 
192292818 311 ATASANISATTQLFNTHGGLTTAAIADGTQLTVNGKTITFKTSDAPQGNNIPTGTGVLGRIGTDGNGNSTIYLGDQTKFS 390 
192292804 311 TGASAPITASTKLFNTVGGLG-AAIADGTTLTVNGKTITFKASDPPSPAGLLVGSGVLGNIVADSQGNSTIYLGTSNTFT 389 
192290923 315 TTAAGNISGATQLFNSHGGLSSTAIADGTTLSVNGKTITFKTSDAPQGNNIASGTGVLGRIGTDGNGNSTIYLGNQSNFT 394 
115526488 420 NAKVEDLLTAIDLANGVKSATISNGVATIATSAGQTPSAVAAGVVTIQSSSGADLNVTGPTDLLKNLGLTTATGSGPLTL 499 
86750923  391 NATVGDLLTAIDLANGVKAASISSGVATISTNSGQTASAVAAGITTIQSSTGGDLNVTAFTDLFKNLGLTTSSGTGPLTL 470 
86750909  390 SATVGDVLTAIDLASGVKSATIANGIATFAAN-GTPSQISAGGAVTLQTSTGADLSITGPADFLSSLNLTASTGPGPATL 468 
115523544 390 PATVGDIMTAIDVASGVKSVSIANGIATYTSN--GSPSSITGGALTLRTSTGADLNINGPADLLNQLSLTASTGPGPTTI 467 
115523542 390 NATVGDLLTAIDLANGVKSATNANGVATIATNAGQTASTTALGVTTIQSSTGGDLNITGWTDLFKNLGLTTASGSGPLTL 469 
39936990  391 NATVGDLLTAIDLANGVKSATISSGVATISTNSGQTASDVTGGITTIRSSTGADLNVTGWTDLFKNLGLTSATGTGPLTL 470 
39936976  390 NATVGDVLTSIDLASGVKSATISGGIATFTAN-GTASSISGAGVVTLNSSTGADLHVTGPADFLKSLNLTTSTGSGPTTL 468 
39935366  438 NATVGDVLTAIDLANGVKSASISNGVATISTSAGQTASSATAGIVTINSSSGADLNLTGPTDLLKNLGLTTSTGSGPLTL 517 
192292818 391 NATVGDLLTAIDLANGVKSATISSGVATISTNSGQTASDVTGGITTIRSSTGADLNVTGWTDLFKNLGLTSATGTGPLTL 470 
192292804 390 NATVGDVLTSIDLASGVKSATISGGIATFTAN-GTASSISGAGVVTLNTSTGADLHVTGPADFLKSLNLTTSTGSGPTTL 468 
192290923 395 NATVGDVLTAIDLANGVKSASISNGVATISTSAGQTASSATAGIVTINSSSGADLNLTGPTDLLKNLGLTTSTGSGPLTL 474 
115526488 500 TKQRTTDGTTLGTLIQDGSTLNVNGKTITFKNAEVPTASASHTGISGNVETDGNGNSTVYLQKGTLDDVMKAVDLATGVR 579 
86750923  471 TKQRTTSGTTMGTLIADGSTLNVNGKTITFKNAAVPTASSSHTGISGNVETDGSGNSTVYLQKGTLDDVLKAIDLATGVR 550 
86750909  469 TATRSTGAGTIGTLIEDGSTLNVNGNIITFKNAPVPLASASHTGISGHVETDGLGNSTVYLQGGTMADVLKAIDLATGVQ 548 
115523544 468 SQPRITSGATTGTLIKDGSTLNVNGKTITFANAPVPLASATHTGITGHIETDGVGNSTVYLQGGTMADVLTAIDLATGVQ 547 
115523542 470 TKQRTTSGTTMGTLIADGSTLNVNGKTITFKNAAVPTASASHQGITGNVETDGQGNSTVYLQKGTLDDVLKAVDLATGVQ 549 
39936990  471 TKQRTTSGTTMGTLIADGSTLNVNGKTITFKNAAVPTASSTHQGISGNVETDGQGNSTVYLQKGTIDDVLKAIDLATGVR 550 
39936976  469 DVPRITGANTIGTLIDDGSILTVNGKTITFKNAPVPLASATHTGVSGHVETDGLGNSTVYLQGGTVADVLKAIDLATGVQ 548 
39935366  518 TKQRTTDGTTLGTLIQDGSTLNVNGHTITFKNAAVPSASASHTGISGNVETDGNGNSTVYLQKGTLDDVLKAVDLATGVR 597 
192292818 471 TKQRTTSGTTMGTLIADGSTLNVNGKTITFKNAAVPTASSTHQGISGNVETDGQGNSTVYLQKGTIDDVLKAIDLATGVR 550 
192292804 469 DVPRITGANTIGTLIDDGSILTVNGKTITFKNAPVPLASATHTGVSGHVETDGIGNSTVYLQGGTVADVLKAIDLATGVQ 548 
192290923 475 TKQRTTDGTTLGTLIQDGSTLNVNGHTITFKNAAVPSASASHTGISGNVETDGNGNSTVYLQKGTLDDVLKAVDLATGVR 554 
115526488 580 KATLGNAGAVISTANGAANSSITSGMLKLSTGLQSDLSITGTGNAMSALGLTGPSGTDSSFSATRGASAGSLNGKSLTFT 659 
86750923  551 VATLGISGATIATANGSANSSITSGSLKLSTGLASDLTINGTGNALAALGLTGPSGTSTSFTATRGVAAGSLNGKSLTFS 630 
86750909  549 TATLSQTGATLTTQTGSANSSLSSGSLKVSTGSASDLTISGTGNAMLALGLAGNTGTSTEFKASRSSGTGGVSGKTLSFT 628 
115523544 548 TAKLAASGATLTTQIGSANSSLSGGSLKISTGTAADLTVTGTGNAMLALGLAGNTGTSTEFAASRSSGTGGVSGKSMTFT 627 
115523542 550 KATLGVSGATVATATGAANSSIASGLLKLSTGLASDLSISGTGNALSALGLTGPSGTATTFTAARGAAAGSLNGKTLTFS 629 
39936990  551 TASLGVSGATISTANGTANSSITSGSLKLSTGLASDLSITGTGNALAALGLTGPSGISTSFTSARGASAGSLNGKTLTFT 630 
39936976  549 TATLSQTGATLTTQLGSANSSLSSGSLKISTGSASDLTISGTGNAMLALGLAGNTGTSTVFQASRASGAGGVSGKTMTFT 628 
39935366  598 KATLGNAGAVISTSNGAANSSITSGMLKLSTGLQSDLSITGTGNAMSALGLTGPSGTDSSFSATRGASAGSLNGKTLSFT 677 
192292818 551 TASLGVSGATISTANGTANSSITSGSLKLSTGLASDLSITGTGNALAALGLTGPSGISTSFTSARGASAGSLNGKTLTFT 630 
192292804 549 TATLSQTGATLTTQLGSANSSLSSGSLKISTGSASDLTISGTGNAMLALGLAGNTGTSTVFQASRASGAGGVSGKTMTFT 628 
192290923 555 KATLGNAGAVISTSNGAANSSITSGMLKLSTGLQSDLSITGTGNAMSALGLTGPSGTDSSFSATRGASAGSLNGKTLSFT 634 
115526488 660 SFNGGAGVNVTFGDGTNGTVKSLAQLNVALAANNMSASIDNATGKLTVSTSNDYASHTMGG-SEGGVLGGTALTTLTFTT 738 
86750923  631 SFNGGSAVNVTLGDGSNGTVKSLAQLNVALAANNLTASIDNASGKLTIAASNDYASRTLGG-ADGGVLGGTLASQLTFTV 709 
86750909  629 SFKGGTPVSVTFGDGTGGTVKTLSQLNVKLATNNMIAQID-ANGKLTISSNNDYASATLGStTDGGTLGGTITATLTFST 707 
115523544 628 SFKGGTPVNITFGDGTGGTVKSLSQLNAKLATNNMIAQVD-ANGLLTISTGNDYASSTLGSiADGGVLGGTITATLTFTT 706 
115523542 630 SFNGGSAVNLTLGDGTNGTVKSLAQLNVALAANNMSASVDNSTGKLTIATSNDYASHTLGG-SDGGVIGGTLASSLVFSI 708 
39936990  631 SFNGGAATNVTFGDGTNGTVKSLAQLNAALASNNLTASIDNASGKLTIAASNDYASHTLGG-SDGGVIGGTLASTLTFSV 709 
39936976  629 SFKGGSPVSVTFGDGTGGTVKTLAQLNAALAPNNLTAQVD-ANGVLMISASNDYASSTLGSvADGGVLGGSITSTLTFTT 707 
39935366  678 SFNGGAGVNVTFGDGTNGTVKSLAQLNVALAANNMSASIDNATGKLTISTSNDYASHTMGG-NEGGVLGGTALTSLTFTT 756 
192292818 631 SFNGGAATNVTFGDGTNGTVKSLAQLNAALASNNLTASIDNASGKLTIAASNDYASHTLGG-SDGGVIGGTLASTLTFSV 709 
192292804 629 SFKGGSPVSVTFGDGTGGTVKTLAQLNAALAPNNLTAQVD-ANGVLMISASNDYASSTLGSvADGGVLGGSITSTLTFTT 707 
192290923 635 SFNGGAGVNVTFGDGTNGTVKSLAQLNVALAANNMSASIDNATGKLTISTSNDYASHTMGG-NEGGVLGGTALTSLTFTT 713 
115526488 739 PQAPVADVNAQNTRAGLVKQFNDILNQIKTTAQDASFNGVNLLNGDNLKLVFNETGKSTISIQGVTFDPTGLGLSNLASG 818 
86750923  710 PTAPVADVNAQNTRAGLVKQFNDVLDQIKTTAQDSSFNGVNLLNGDNLKLVFNETGKSTISIQGVTFNPTGLGLSTLASG 789 
86750909  708 PNPPEPDVTAQVARAKLVEQYNNVIQQITTTSQDASFNGVNLLNGDTLKLVFNETGKSTLNIVGTALSPAALGLPTLVSG 787 
115523544 707 PQEPVADTNSQLARANLVRQFNNVIAQISTTSQDASFNGVNLLNGDTLKLVFNETGKSTLNIVGTALTAAQLGLSTLVEG 786 
115523542 709 PAAPVADVNAQTTRAGFVKQFNGILDQIKTTAEDASFNGVNLLNGDTLKLVFNETGKSTITIQGVTNNPTGLGLSALTSG 788 
39936990  710 PNAPVVDVNAQTTRAGLVKQFNDVLDQIKTTAQDASFNGVNLLNGDTLKLVFNETGKSTISIQGVTFNPTGLGLSNLSSG 789 
39936976  708 PNPPVADLNSQAARAKLVEQYNNVIAQITTTSQDASFNGVNLLNGDTLKLVFNETGKSTLTIVGTALTPAALGLPTLVAG 787 
39935366  757 PQAPVADVNAQNTRAGLVKQFNDILNQIKTTAQDASFNGVNLLNGDNLKLVFNETGKSTISIQGVTFDPTGLGLSNLSSG 836 
192292818 710 PNAPVVDVNAQTTRAGLVKQFNDVLDQIKTTAQDASFNGVNLLNGDTLKLVFNETGKSTISIQGVTFNPTGLGLSNLSSG 789 
192292804 708 PNPPVADLNSQAARAKLVEQYNNVIAQITTTSQDASFNGVNLLNGDTLKLVFNETGKSTLTIVGTALTPAALGLPTLVAG 787 
192290923 714 PQAPVADVNAQNTRAGLVKQFNDILNQIKTTAQDASFNGVNLLNGDNLKLVFNETGKSTISIQGVTFDPTGLGLSNLSSG 793 
115526488 819 VDFIDNKATNAVLDKLSAASTTLRSQASAFGSNLSVVQARQDFSKSLISVLQTGSANLTLADTNEEAANSQALSTRQSIA 898 
86750923  790 TDFIDNNATNSVLTKLSAASTALRSQSSAFGSNLSIVQARQDFSKSLINVLQTGSSNLTLADTNEEAANSQALTTRQSIA 869 
86750909  788 VDFIDNASTNKTLASLNTAATTLRSQASSYGSNLSIVQIRQDFAKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIA 867 
115523544 787 FDFIDNAATNKTMAALNTASTSLRSQASAYGSNLSIVQIRQDFSKNLISVLQTGSSNLTLADTNEEAANSQALSTRQSIA 866 
115523542 789 TDFIDNTATNAVLAKLSTASTTLRSQASAFGSNLSIVQARQEFSKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIA 868 
39936990  790 VDFIDNNATNAVLSKLSTASTALRSQASAFGSNLSIVQARQDFSKSLINVLQTGSSNLTLADTNEEAANSQALTTRQSIA 869 
39936976  788 TDFIDNAATNKTLAALNTASTTLRSQASSYGSNLSIVQIRQNFAKSLINVLQTGSANLTLADTNEEAANSQALSTRQSIA 867 
39935366  837 VDFIDNNATNAVLTKLSTASTTLRSQASAFGSNLSVVQARQDFSKSLINVLQTGSANLTLADTNEEAANSQALSTRQSIA 916 
192292818 790 VDFIDNNATNAVLSKLSTASTALRSQASAFGSNLSIVQARQDFSKSLINVLQTGSSNLTLADTNEEAANSQALTTRQSIA 869 
192292804 788 TDFIDNAATNKTLAALNTASTTLRSQASSYGSNLSIVQIRQNFAKSLINVLQTGSANLTLADTNEEAANSQALSTRQSIA 867 
192290923 794 VDFIDNNATNAVLTKLSTASTTLRSQASAFGSNLSVVQARQDFSKSLINVLQTGSANLTLADTNEEAANSQALSTRQSIA 873 
115526488 899 VSALGLANQSQQGVLQLLR 917 
86750923  870 VSALSLANQSQQSVLQLLR 888 
86750909  868 VSALALANQSQQSVLQLLR 886 
115523544 867 VSALALANQSQQSVLKLLQ 885 
115523542 869 VSALSLANTSQQGVLQLLR 887 
39936990  870 VSALSLANQSQQGVLQLLR 888 
39936976  868 VSALSLANQSQQSVLQLLR 886 
39935366  917 VSALSLANQSQQGVLQLLR 935 
192292818 870 VSALSLANQSQQGVLQLLR 888 
192292804 868 VSALSLANQSQQSVLQLLR 886 
192290923 874 VSALSLANQSQQGVLQLLR 892 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap