Conserved Protein Domain Family
PRK14707

?
PRK14707: PRK14707 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173170
View PSSM: PRK14707
Aligned: 3 rows
Threshold Bit Score: 5067.78
Threshold Setting Gi: 84625802
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188574644    1 MSMAYDNELAHRMRNGMALPFLEESVNAQVNAQRLDKYLQLIATARRARAGVTPRDLDRCTELAAQYLSGTGWFEGASLA 80  
58584024   232 VSMAYDNELAHRMRNGMALPFLEESVNAQVNAQRLDKYLQLIATARRARAGVTPRDLDRCTELAAQYLSGTGWFEGASLA 311 
84625802   218 MSMAYDNELAHRMRNGMALPFLEESVNAQVNAQRLDKYLQLIATARRARAGVTPRDLDRCTELAAQYLSGTGWFEGASLA 297 
188574644   81 QLAHVGNKLSKHPNQPACMEAIAWIAGELTQADDLVGLGGYPSALFLNAFSKNLDSGRCERAVARLARHLRREDKARQTL 160 
58584024   312 QLAHVGNKLSKHPNQPACMEAIAWIAGELTQADDLVGLGGYPSALFLNAFSKNLDSGRCERAVARLARHLRREDKARQTL 391 
84625802   298 QLAHVGNKLSKHPNQPACMEAIAWIAGELTQADDLVGLGGYPSALFLNAFSKNLDSGRCERAVARLARHLRREDNARQTL 377 
188574644  161 NAQNISLALNAFSKWSDNPDCQAVAPRFAALVASDDRLRSAMDAQGVATVLNALCKWPDTPDCGNAVSALAERLADESRL 240 
58584024   392 NAQNISLALNAFSKWSDNPDCQAVAPRFAALVASDDRLRSAMDAQGVATVLNALCKWPDTPDCGNAVSALAERLADESRL 471 
84625802   378 NAQNISLALNAFSKWSDNPDCQAVAHRFAALVASDDRLRSAMDAQGVATALNALCKWPDTPDCGNAVSALAERLADESRL 457 
188574644  241 RNELKPQELGNALNALSKWADTPVCAAAASALAERLVDDPGLRKALDPINVTQALNALSKWADLPVCAEAAIALAERLAD 320 
58584024   472 RNELKPQELGNALNALSKWADTPVCAAAASALAERLVDDPGLRKALDPINVTQALNALSKWADLPVCAEAAIALAERLAD 551 
84625802   458 RNELKPQELGNALNALSKWADTPVCAAAASALAERLVDDPGLRKALDPINVTQALNALSKWADLPVCAEAAIALAERLAD 537 
188574644  321 DPELCKALNARGLSTALNALSKWPDNPVCAAAVSALAERLVADPELRKDLEPQGVSSVLNALSKWPDTPVCAAAASALAE 400 
58584024   552 DPELCKALNARGLSTALNALSKWPDNPVCAAAVSALAERLVADPELRKDLEPQGVSSVLNALSKWPDTPVCAAAASALAE 631 
84625802   538 DPELCKALNARGLSTALNALSKWPDNPVCAAAVSALAEWLVADPELRKDLEPQGVSSALNALSKWPDTPVCAAAASALAE 617 
188574644  401 HVVDDLELRKGLDPQGVSNALNALAKWPDLPICGQAVSALAGRLAHDTELCKALDPINVTQALDALSKWPDTPICGQTAS 480 
58584024   632 HVVDDLELRKGLDPQGVSNALNALAKWPDLPICGQAVSALAGRLAHDTELCKALDPINVTQALDALSKWPDTPICGQTAS 711 
84625802   618 HVVDDLELRKGLDPQGVSNALNALAKWPDLPICGQAVSVLAGRLAHDTELCKALDPINVTQALDALSKWPDTPICGQTAS 697 
188574644  481 ALAARLAHERRLRKALKPQEVVIALHSLSKWPDTPICAEAASALAERVVDELQLRKAFDAHQVVNTLKALSKWPDKQLCA 560 
58584024   712 ALAARLAHERRLRKALKPQEVVIALHSLSKWPDTPICAEAASALAERVVDELQLRKAFDAHQVVNTLKALSKWPDKQLCA 791 
84625802   698 ALAARLAHERRLRKALKPQELVIALHSLSKWPDTPICAEAASALAERVVDELQLRKAFDAHQVVNTLKALSKWPDKQVCA 777 
188574644  561 VAASGLAERLADEPQLPKDLHRQGVVIVLNALSKWPDTAVCAEAVNALAERLVDEPDLRKELDPVDVTNVLNALSKWPGT 640 
58584024   792 VAASGLAERLADEPQLPKDLHRQGVVIVLNALSKWPDTAVCAEAVNALAERLVDEPDLRKELDPVDVTNVLNALSKWPGT 871 
84625802   778 VAASGLAERLADEPQLPKDLHRQGVVIVLNALSKWPDTAVCADAVNVLAERLVDEPDLRKELDPVDVTNVLNALSKWPGT 857 
188574644  641 EVCAEVARLLAGRLVGDRLLRKTFNSLDVANALNALSKWPDTPVCAAAAGGMAERLAADPGLRKELNPVDVANALNALSK 720 
58584024   872 EVCAEVARLLAWRLVGDRLLRKTFNSLDVANALNALSKWPDTPVCAAAAGGMAERLAADPGLRKELNPVDVANALNALSK 951 
84625802   858 EVCAEVARLLAGRLVGDRLLRKTFNSLDVVNALNALSKWPDTPVCAAAAGALAERLAADPGLRKELNPVDVANALNALSK 937 
188574644  721 WPRTPVCAAVASALAARVVAEPRLRKAFDAQQVATALNALSKWPDNQACAAAANTLAERQLREPDVRDVLKPREMTNALN 800 
58584024   952 WPRTPVCAAVASALAARVVAEPRLRKAFDAQQVATALNALSKWPDNQACAAAANTLAERQLREPDVRDVLKPREMTNALN 1031
84625802   938 WPRTPVCAAVASALAARVVAEPRLRKAFDAQQVATALNALSKWPDNQACAAAANTLAERQLREPDVRDVLKPREMTNALN 1017
188574644  801 ALSKWPDTPACAAAASALAARVADDPRLREAFDVQHVATVLNAMSKWPDNAVCAAAAGAMAERLADEPELRHTLTAHGVV 880 
58584024  1032 ALSKWPDTPACAAAASALAARVADDPRLREAFDVQHVATVLNAMSKWPDNAVCAAAAGAMAERLADEPELRHTLTAHGVV 1111
84625802  1018 ALSKWPDTPACAAAASALAARVADDPRLREAFDVQHVATVLNAMSKWPDNAVCAAAAGALAERLADEPELRHTLTAHGVV 1097
188574644  881 IVLNALSKWPNVPVCAAAASALAERLADEPELRKALSAHRVATALNALSKWPDIPVCATAASALAERLSDDPDLREALDA 960 
58584024  1112 IVLNALSKWPNVPVCAAAASALAERLADEPELRKALSAHRVATALNALSKWPDIPVCATAASALAERLSDDPDLREALDA 1191
84625802  1098 IVLNALSKWPNVPVCAAAASALAERLADEPELRKALSAHRVATALNALSKWPDIPVCATAASALAERLSDDPDLREALDA 1177
188574644  961 SNLPQVLNALSKWPDVPAGGEVVDALAERLVDEPALRNALDPIGMANALNALSKWLQMPVCAATVEALAARLSNDPGLCK 1040
58584024  1192 SNLPQVLNALSKWPDVPAGGEVVDALAERLVDEPALRNALDPIGMANALNALSKWLQMPVCAATVEALAARLSNDPGLCK 1271
84625802  1178 SNLPQVLNALSKWPDVPAGGEVVDALAERLVDEPALRNALDPIGMANALNALSKWLQMPVCAATVEALAARLSNDPGLCK 1257
188574644 1041 ALSSQGLTTVLNALCKWPEMPVCLAAASALAERLSDDLVLRNALDSQGFGNALNALSKWPDSPVCAAAASALAKRLTDDA 1120
58584024  1272 ALSSQGLTTVLNALCKWPEMPVCLAAASALAERLSDDLVLRNALDSQGFGNALNALSKWPDSPVCAAAASALAKRLTDDA 1351
84625802  1258 ALSSQGLTTVLNALCKWPEMPVCLAAASALAERLSDDLVLRNALDSQGFGNALNALSKWPDSPVCAAAASALAKRLTDDA 1337
188574644 1121 GLRHVFDPINVSQALNALSKWPGTQACESAIDVLAATLANAPGLRNALSAQGVAIALNALSKCLARPVCRSAFVLLAERA 1200
58584024  1352 GLRHVFDPINVSQALNALSKWPGTQACESAIDVLAATLANAPGLRNALSAQGVAIALNALSKCLARPVCRSAFVLLAERA 1431
84625802  1338 GLRHAFDPINVSQALNALSKWPGTQACESAIDVLAATLANAPGLRNALSAQGVAIALNALSKCLARPVCRSAFVLLAERA 1417
188574644 1201 GSAELPWRQFEMRGIAVVANAMSRLSPLDEEDDEQFRTLAVAKLQAMAGHLDLHRELFASASVADIGVLFKALASARLQR 1280
58584024  1432 GSAELPWRQFEMRGIAVVANAMSRLSPLDEEDDEQFRTLAVAKLQAMAGHLDLHRELFASASVADIGVLFKALASARLQR 1511
84625802  1418 GSAELPWRQFEMRGIAVVANAMSRLSPLDEEDDEQFRTLAVAKLQAMAGHLDLHRERFASASATDIGVLFKALASARLQR 1497
188574644 1281 QMRSLGQPALERVSALIGDDGLRQTSLEGIGSLCMGLLPLIRSPELTPRHRGQALHVFNTLQPIVARKIDLYLRSDGARA 1360
58584024  1512 QMRSLGQPALERVSALIGDDGLRQTSLEGIGSLCMGLLPLIRSPELSPRHRVQALRVFDTLQPIVARKIDLYLGGDGARA 1591
84625802  1498 QMRSLGQPALERVSALIGDDGLRQTSLEGIGSLCMGLLPLIRSPELTPRHRGQALHVFNTLQPIVARKIDLYLRSDGARA 1577
188574644 1361 SAAVEQHATRCPALTFYQVLKAYAVVSRQWKARHLDGPRKQLRQRRDELLKWVDLTLARTREAIEADLGEMSWNLIAQIE 1440
58584024  1592 AAAVEQHATRCPALTFYQVLKAYAVVSRQWKARHLDGPRKQLRQRRDELLKWVDLTLACTREAIEADLGEMSWNLIAQIE 1671
84625802  1578 SAAVEQHATRCPALTFYQVLKAYAVVSRQWKARHLDGPRKQLRQRRDELLKWVDLTLARTREAIEADLGEMSWNLIAQIE 1657
188574644 1441 AGEQVFDALDLRMAKDAPAITQAHPPTRFDLDSGRLSMASVPGRPVAPAPGRGSTTHVVVDLVGKELSTNRSESDKPYSL 1520
58584024  1672 AGDQVFDALDLRMAKDAPAITQAHPPTRFDLDSGRLSMASVPGRPVAPAPGRGSTTHVVVDLVGKELSTNRSESDKPYSL 1751
84625802  1658 AGEQVFDALDLRMAKDAPAITQAHPPTRFDLDSGRLSMASVPGRPVAPAPGRGSTTHVVVDLVGKELSTNRSESDKPYSL 1737
188574644 1521 FARLTGLPLVEVQLPGELSTFMLARTFNYNGEPWRFDLFGGSRAARSKSGSGSLVLSHRKESASLLPAFRYADTAPGSSL 1600
58584024  1752 FARLTGLPLVEVQLPGELSTFMLARTFNYNGEPWRFDLFGGSRAARSKSGSGSLVLSHRKESASLLPAFRYADTAPGSSL 1831
84625802  1738 FARLTGLPLVEVQLPGELSTFMLARTFNYNGEPWRFDLFGGSRAARSKSGSGSLVLSHRKESASLLPAFRYADTAPGSSL 1817
188574644 1601 MHLAAKLAPQREDWSRMQRSLLEMVPSDHVVEGTLRLGVFDDVEGPAHPFKPLAVDGTALALCPNDGCGFLKLEVALAIP 1680
58584024  1832 MHLAAKLAPQREDWSRMQRSLLEMVPSDHVVEGTLRLGVFDDVEGPAHPFKPLAVDGTALALCPNDGCGFLKLEVALAIP 1911
84625802  1818 MHLAAKLAPQREDWSRMQRSLLEMVPSDHVVEGTLRLGVFDDVEGPAHPFKPLAVDGTALALCPNDGCGFLKLEVALAIP 1897
188574644 1681 AFRKHYDAWHAVQANQATEEQRDLVAKDKGPSMMPAQALHHYPRDAAALEEAHAAMQERLQTLEPAGDDPLWVYRPLIGG 1760
58584024  1912 AFRKHYDAWHAVQANQATEEQRDLVAKDKGPSMMPAQALHHYPRDAAALEEAHAAMQERLQTLEPAGDDPLWVYRPLIGG 1991
84625802  1898 AFRKHYDAWHAVQANQATEEQRDLVAKDKGPSMMPAQALHHYPRDAAALEEAHAAMQERLQTLEPAGDDPLWVYRPLIGG 1977
188574644 1761 GYKGQRVRAVPSADDKVHLPQQRSQAFDVTGGPLLLGKPPYDKENLLPVPEQRIATVAKGDATAAFLSQCFGIQYSYTGF 1840
58584024  1992 GYKGQRVRAVPSADDKVHLPQQRSQAFDVTGGPLLLGKPPYDKQNLLPVPEQRIATVAKGDATAAFLSQCFGIQYSYTGF 2071
84625802  1978 GYKGQRVRAVPSADDKVHLPQQRSQAFDVTGGPLLLGKPPYDKENLLPVPEQRIATVAKGDATAAFLSQCFGIQYSYTGF 2057
188574644 1841 DDRSGVDPQMLHSKGMLVVVPEQQWPAAFSDTDLACSKEDLKTLSCWTNGRDRGALPRDILSTGSLRLKDIVEPGRLGAL 1920
58584024  2072 DDRSGVDPQMLHSKGMLVVVPEQQWPAAFSDTDLACSKEDLKTLSCWTNGRDRGALPRDILSTGSLRLKDIVEPGRLGAL 2151
84625802  2058 DDRSGVDPQMLHSKGMLVVVPEQQWPAAFSDTDLACSKEDLKTLSCWTNGRDRGALPRDILSTGSLRLKDIVEPGRLGAL 2137
188574644 1921 PIDELRKRDMDTDGDDAFIYAGYPKLAALISRVMDRKARLGRQKSFKPPKTATPAIDPVSGHYQPGRLSEIMALKRGQRI 2000
58584024  2152 PIDELRKRDMDTDGDDAFIYAGYPKLAALISRVMDRKARLGRQKSFKPPKTATPAIDPVSGHYQPGRLSEIMALKRGQRI 2231
84625802  2138 PIDELRKRDMDTDGDDAFIYAGYPKLAALISRVMDRKARLGRQKSFKPPKTATPAIDPVSGHYQPGRLSEIMALKRGQRI 2217
188574644 2001 TSAAATLAARFMGQPDELREAMARDMMFGTYDGIERGLRDGLRELLEEQVRDPQVLATLRVQAREAIKRAHLPEAREAAE 2080
58584024  2232 TSAAATLAARFMGQPDELREAMARDMMFGTYDGIERGLRDGLRELLEEQVRDPQVLATLRVQAREAIKRAHLPEAREAAE 2311
84625802  2218 TSAAATLAARFMGQPDELREAMARDMMFGTYDGIERGLRDGLRELLEEQVRDPQVLATLRVQAREAIKRAHLPEAREAAE 2297
188574644 2081 LLHAQLRALAADPAADSAAPALPEALAEAFPGLAKAYEAASGVDARIHAILDNYPVCRLSHAQFPDGQPGLVPGEPELTM 2160
58584024  2312 LLHAQLRALAADPAADSAAPALPEALAEAFPGLAKAYEAASGVDARIHAILDNYPVCRLSHAQFPDGQPGLVPGEPELTM 2391
84625802  2298 LLHAQLRALAADPAADSAAPALPEALAEAFPGLAKAYEAASGVDARIHAILDNYPVCRLSHAQFPDGQPGLVPGEPELTM 2377
188574644 2161 RNLFTIAIKVGTDALKSDTGTALFAKIVEACERAERCFAERVRSLPYSRVTARAMQDGRFDPEQTKLLLQRMPSMAAGVM 2240
58584024  2392 RNLFTIAIKVGTDALKSDTGTALFAKIVEACERAERGFAERVRSLPYSRVTARAMQDGRFDPEQTKLLLQRMPSMAAGVM 2471
84625802  2378 RNLFTIAIKVGTDALKSDTGTALFAKIVEACERAERCFAERVRSLPYSRVTARAMQDGRFDPEQTKLLLQRMPSMAAGVM 2457
188574644 2241 EDALEALQQAGWIDRSQPPAERLRDVQPQDIALKAQTLLGRARQMEPQVTDMLQNIAARHGGQLAGTQHQLKSYSSLQEK 2320
58584024  2472 EDALEALQQAGWIDRSQPPAERLRDVQPQDIALKAQTLLGRARQMEPQVTDMLQNIAARHGGQLAGTQHQLKSYSSLQEK 2551
84625802  2458 EDALEALQQAGWIDRSQPPAERLRDVQPQDIALKAQTLLGRARQMEPQVTDMLQNIAARHGGQLAGTQHQLKSYSSLQEK 2537
188574644 2321 LKQRVALKKQSLEEAAASVNDALCYSVVLEPQGFTAGLRAVLAALDDQGHARVKLTNQFTEYSPSFKAINLTLRSPEGAL 2400
58584024  2552 LKQRVALKKQSLEEAAASVNDALRYSVVLEPQGFTAGLRAVLAALDDQGHARVKLTNQFTEYSPSFKAINLTLRSPEGAL 2631
84625802  2538 LKQRVALKKQSLEEAAASVNDALRYSVVLEPQGFTAGLRAVLAALDDQGHARVKLTNQFTEYSPSFKAINLTLRSPEGAL 2617
188574644 2401 WEIQFHTPETFALKERFHDLYKRTHALALGGASRAEQRTLQAPALEAFKRVASPPGCEEIDDWQEETVPALAGTPPALAS 2480
58584024  2632 WEIQFHTPETFALKERFHDLYKRTHALALGGASRAEQRTLQAPALEAFKRVASPPGCEEIDDWQEETVPALAGTPPALAS 2711
84625802  2618 WEIQFHTPETFALKERFHDLYKRTHALALGGASRAEQRTLQAPALEAFKRVASPPGCEEIDDWQEETVPALAGTPPALAS 2697
188574644 2481 EQTPVNAGASPAHRVFNAATGKQASLTPVLNTLADGLGARLWGNVRYKASQGRIEQVQQAPFQKSLASIKDKIRRHLRAG 2560
58584024  2712 EQTPVNAGASPAHRVFNAATGKQASLTPVLNTLADGLGARLWGNVRYKASQGRIEQVQQAPFQKSLASIKDKIRRHLRAG 2791
84625802  2698 EQTPVNAGASPAHRVFNAATGKQASLTPVLNTLADGLGARLWGNVRYKASQGRIEQVQQAPFQKSLASIKDKIRRHLRAG 2777
188574644 2561 MTAEQATQSVGDALRYALELPSEGFVAKVQAAQDALRRQGMTCVNLQNYFTSGDGTYRGINASFTDAEGYAFEVQFHTAE 2640
58584024  2792 MTAEQATQSVGDALRYALELPSEGFVAKVQAAQDALRRQGMTCVNLQNYFTSGDGTYRGINASFTDAEGYAFEVQFHTAE 2871
84625802  2778 MTAEQATQSVGDALRYALELPSEGFVAKVQAAQDALRRQGMTCVNLQNYFTSGDGTYRGINASFTDAEGYAFEVQFHTAE 2857
188574644 2641 SFNAKAQTHLSYKRMQLAQARLDRERQKPQPDPIRQANLTQEIAGHKKAMHEMTANVSKPAYIERLGGRA 2710
58584024  2872 SFNAKAQTHLSYKRMQLAQARLDRERQKPQPDPIRQANLTQEIAGHKKAMHEMMANVSKPAYIERLGGRA 2941
84625802  2858 SFNAKAQTHLSYKRMQLAQARLDRERQKPQPDPIRQAKLTQEIAGHKKAMHEMTANVSKPAYIERLGGRA 2927
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap