Conserved Protein Domain Family
PRK14700

?
PRK14700: PRK14700 
recombination factor protein RarA; Provisional
Statistics
?
PSSM-Id: 173163
View PSSM: PRK14700
Aligned: 8 rows
Threshold Bit Score: 611.633
Threshold Setting Gi: 134301521
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89256012    1 MPYVESGKIILIGATTENTTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
115314491   1 MPYVESGKIILIGATTENTTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
110670956   1 MPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
156502015   1 MPYVESGKIILIGATTENTTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
134301521   1 MPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
118497986 113 LPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKTLSQDEVLAKHKFKIDDGLYNSMHNYSEGD 192
56708485    1 MPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQKLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGD 80 
167627500 113 LPYVESGKIILIGATTENPTYYLNNALVSRVFILRLKRLNISETRKLIQRAITKDELLAKHSFEIDDDLYNAIHNYSEGD 192
89256012   81 CRKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
115314491  81 CRKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
110670956  81 CCKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
156502015  81 CRKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
134301521  81 CCKILNLLERMFLISTRGDEIYLNKELFDQAVGETLRDFHREGKDFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
118497986 193 CRKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 272
56708485   81 CCKILNLLERMFLISTRGDEIYLNKELFDQAVGETSRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPL 160
167627500 193 CRKILNLLERMFLISDRTNTIHLDKDLFDQAVGEASRDFHREGKEFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGADPL 272
89256012  161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMLEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 240
115314491 161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMLEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 240
110670956 161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 240
156502015 161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMLEGRLVLAQAAIYLAVAPKSNACYKALVQAQQLVKSLGNIDVP 240
134301521 161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 240
118497986 273 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 352
56708485  161 VIARRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYKALAQAQQLVKSLGNIDVP 240
167627500 273 VIARRMLCIASEDIGNADPQALRVAIDAWNAYEKLGMPEGRLVLSQAAIYLAVAPKSNACYKALADAQQIVKSLGNIEVP 352
89256012  241 QHLKNYKNSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
115314491 241 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
110670956 241 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
156502015 241 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
134301521 241 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
118497986 353 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 412
56708485  241 QHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTASGFEAKIKTKLDSINKIKKL 300
167627500 353 QHLKNYKDSNYLYPHNYPNSYVIQQYLPKNLKRSFYNPTSHGFESKIKNKLDSIKVSKN- 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap