Conserved Protein Domain Family
PRK14699

?
PRK14699: PRK14699 
replication factor A; Provisional
Statistics
?
PSSM-Id: 173162
View PSSM: PRK14699
Aligned: 3 rows
Threshold Bit Score: 938.654
Threshold Setting Gi: 73668500
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21227401   1 MTDIETIYKKLSHVISKEDFLQRIQEKVENMGGLCDETMAAMLVANELGFSDAGRDSIKIENITPESGPVNFIARIISVF 80 
73668500   1 MTDIESIYKKLSHVISKEDFLQRVQEKVESMGGLCDEPMAAMLVANELGFSDVGRDSVKIENITAESGQINFVAKVVSVF 80 
20093424   1 MTDIETIYKKLSHVISREDFLKRIEEKVENMGGLCDEAMAAMLVANELGFSDAGRENLKIENITPETGPVNFIARVVSVF 80 
21227401  81 DTKEFTRNDGTIGRVGNLIVGDETGKVKLTLWDNMADLIKMGKIKAGQSVQVSGFAKQGYSGVEVNIGNNGVLTESEEEI 160
73668500  81 DTKEFTRNDGTIGRVGNIIVGDETGKIRLTLWDNMADLIKAGKIIAGQTLQISGYAKQGYSGVEVNVGNNGVLAESEEEI 160
20093424  81 DVKEFTRNDGTIGRVGNLIVGDETGKLKLTLWDNMADLIKAGKVKVGQTIQISGYAKQGYSGVEVNIGNNGVLTESEEEV 160
21227401 161 DVVSNSYKIKDIKDGMGDINLNGKVLEVSEIRTFQRKDGNSGRVGNLMLGDETGTLRVTLWDDKTDFLSQVEYGDSIELI 240
73668500 161 DVAANNQKIKDIKDGMGDLNLTGKVLEISEVRTFQRKDGTSGKVGNLLLGDSTGTVRVTLWDDRTEFLNQIEYGDTVELV 240
20093424 161 DVAASSQKIKDIKDGMGDLNLTGKVLEISEIRTFQRKDGSGGKVGNLLIGDETGTLRVTLWDEKTDFLNQLEYGDTVELI 240
21227401 241 NAYARENAFSQKVELQVGNRSIIRKSEKKIEYEEEFTPIDDIKADMNNINISGRILDISEVRTFEKKDGSTGRVGNVLLG 320
73668500 241 NAYARENAFTQKVELQVGNRSIIKKSEKKVEYEEEFAPIEDIRADMNNINVSGRVLDIGEIRTFEKKDGSPGRVGNLLLG 320
20093424 241 NAYARENAFTQKVELQIGNRSIIRKSEKKVEYEETFTPVADIKADMNNINISGRVLDISEVRTFEKKDGTAGRVANILLG 320
21227401 321 DSTGKIRLTLWDEKTDILEEIDFDETVEVLNAYSRENTFSQQVELNLGARGIIQRSEKKVEYREKFTDIADIIPGESYSI 400
73668500 321 DSTGKIRLTLWDEKTNFLDEVDFDETIEVLHAYSRENAFNQQVELNLGNRGIIQKSEKEIEYREKFTDIADIIPGESYSV 400
20093424 321 DSTGKIRLTVWDEKTESLDDIDFDDTVEVLNAYSRENTFSQQVELSLGARGIIQKSEKKVEYREKFTDIADIIPGESYSV 400
21227401 401 QGKVAEIGELREFEKEDGTENVVANLQLKDDTGSIRLTLWGEQAYVIEDLDIDSEIQIIDAYARYGLNEEIELSVGNRSR 480
73668500 401 QGKVSEIGELREFEREDGTENVVANLQLKDETGSIRLTLWGEQAYVIEDLDIDSEIQIINAYAKYGLNEEIELSIGNRSR 480
20093424 401 QGKVSEIGELREFEREDGTENVVANLQLEDETGSIRLTFWGEQAYVIEDLDIDSEIQIIDAYARYGLNEEIELSVGNRSR 480
21227401 481 VIIL 484
73668500 481 VIML 484
20093424 481 VIIL 484
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap