Conserved Protein Domain Family
PRK14695

?
PRK14695: PRK14695 
serine/threonine transporter SstT; Provisional
Statistics
?
PSSM-Id: 173158
View PSSM: PRK14695
Aligned: 6 rows
Threshold Bit Score: 503.044
Threshold Setting Gi: 15903640
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225859505   1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDSPVNALLTANYIGILSWAVIFGIAMREAsk 80 
194397681   1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDNPVNALLTANYIRILSWAVIFGIAMREA-- 78 
182684697   1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDNPVNALFTANYIGILSWAVIFGIAMREA-- 78 
221232489   1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDSPVNALLTANYIGILSWAVIFGIAMREA-- 78 
15903640    1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDSPVNALLTANYIGILSWAVIFGIAMREA-- 78 
116516711   1 MIGTFAAALVAVLASFIVPIEITLNSANTEIAPPDGIGQVLSNLLLKLVDSPVNALLTANYIGILSWAVIFGIAMREA-- 78 
225859505  81 tSKNSKELLKTIADVTSKIVEWIINLAPFGILGLVFKTISDKGVGSLANYGILLVPLVTTMLFVAPVVNPLITFFFMRRN 160
194397681  79 -SKNSKELLKTIADVTSKIVEWIINLAPFGILGLVFKTISDKGVGSLANYGILLVLLVTTMLFVAPVVNPLIAFFFMRRN 157
182684697  79 -SKNSKELLKTIADVTSKIVEWIINLAPFGILGLVFKTISDKGVGSLANYGILLVPLVTTMLFVAPVVNPLIAFFFMRRN 157
221232489  79 -SKNSKELLKTIADVTSKIVEWIINLTPFGILGLVFKTISDKGVGSLANYGILLVLLVTTMLFVAPVVNPLIAFFFMRRN 157
15903640   79 -SRNSKELLKTIADVTSKIVEWIINLTPFGILGLVFKTISDKGVGSLANYGILLVLLVTTMLFVAPVVNPLIAFFFMRRN 157
116516711  79 -SRNSKELLKTIADVTSKIVEWIINLTPFGILGLVFKTISDKGVGSLANYGILLVLLVTTMLFVAPVVNPLIAFFFMRRN 157
225859505 161 PYSLVWNCLRVSGVTAFFTRSSATNIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINVLTLVTVNTLGIPVDFA 240
194397681 158 PYPLVWNCLRVSGVTAFFTRSSATNIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINVLTLVTVNTLGIPVDFA 237
182684697 158 PYPLVWNCLRVSGVTAFFTRSSATNIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLVTVNTLGIPVDFA 237
221232489 158 PYPLVWNCLRVSGVTAFFTRSSAANIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLVTVNTLGIPVDFA 237
15903640  158 PYPLVWNCLRVSGVTAFFTRSSAANIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLVTVNTLGIPVDFA 237
116516711 158 PYPLVWNCLRVSGVTAFFTRSSAANIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLVTVNTLGIPVDFA 237
225859505 241 TAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQVVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 320
194397681 238 TAFVLSVVAAISACDASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 317
182684697 238 TAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQVVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 317
221232489 238 TAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 317
15903640  238 TAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 317
116516711 238 TAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIGVIQDSCETALNSSTDVLFTAVAEYAATR 317
225859505 321 KK 322
194397681 318 KK 319
182684697 318 KK 319
221232489 318 KK 319
15903640  318 KK 319
116516711 318 KK 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap