Conserved Protein Domain Family
PRK14693

?
PRK14693: PRK14693 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173156
View PSSM: PRK14693
Aligned: 9 rows
Threshold Bit Score: 1014.3
Threshold Setting Gi: 83717203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83717203   20 MLDRAAANPDLVTRVPTLSSLTSAAMTSSAVSTTGTTNVAASGGAASGMGVPGAYPAADVPHADGAPRNPAVLQFPVPGG 99 
53721567    1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
53716506   20 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 99 
124383073   1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
121597986   1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
126457957   1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
126442377   1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
126447196   1 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 80 
76819156   20 MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNPAVLQFPVPGG 99 
83717203  100 AH--------APADARDAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 171
53721567   81 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 152
53716506  100 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 171
124383073  81 APapadarvaAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 160
121597986  81 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 152
126457957  81 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 152
126442377  81 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 152
126447196  81 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 152
76819156  100 AP--------APADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQAAIRTQLGLEVR 171
83717203  172 LYRERLAGSGCEWEQIRDASYLLCTYLDETVNDSAREHSQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKADQPPIPL 251
53721567  153 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 232
53716506  172 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 251
124383073 161 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 240
121597986 153 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 232
126457957 153 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 232
126442377 153 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 232
126447196 153 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 232
76819156  172 LYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPL 251
83717203  252 LSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTDLATPAKRRRSWWTAGRAAAVALGVLVLAYGA 331
53721567  233 LSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 312
53716506  252 LSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 331
124383073 241 LSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 320
121597986 233 LSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 312
126457957 233 LSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 312
126442377 233 LSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 312
126447196 233 LSFYELILSLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 312
76819156  252 LSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAAVALGVLVLAYGA 331
83717203  332 ISLWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKAKVRPDFMHNIE 411
53721567  313 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 392
53716506  332 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 411
124383073 321 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 400
121597986 313 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 392
126457957 313 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 392
126442377 313 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 392
126447196 313 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 392
76819156  332 ISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIE 411
83717203  412 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARTVADELRATALPGGARAPENAVQRNIEYSGRGDAQPIDT 491
53721567  393 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 472
53716506  412 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 491
124383073 401 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 480
121597986 393 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 472
126457957 393 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 472
126442377 393 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 472
126447196 393 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 472
76819156  412 RLGLAFAPWPGDLEVIGHTDSRPIRTSEFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDT 491
83717203  492 AKTAAAYERNRRVDVLWKVIPDGASQPGRSLNLQQPEKPGQVPMRPAMPEGVEIAPEGQLPYAtteittatpttmpttkq 571
53721567  473 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 535
53716506  492 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 554
124383073 481 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 543
121597986 473 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 535
126457957 473 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 535
126442377 473 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 535
126447196 473 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 535
76819156  492 AKTAAAYERNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYA----------------- 554
83717203  572 aptpvpTPAPTPATGPTTEGRQP 594
53721567  536 ------TSTTMPATRPTTEGRQP 552
53716506  555 ------TSTTMPATRPTTEGRQP 571
124383073 544 ------TSTTMPATRPTTEGRQP 560
121597986 536 ------TSTTMPATRPTTEGRQP 552
126457957 536 ------TSTTMPATRPTTEGRQP 552
126442377 536 ------TSTTMPATRPTTEGRQP 552
126447196 536 ------TSTTMPATRPTTEGRQP 552
76819156  555 ------TSTTMPATRPTTEGRQP 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap