Conserved Protein Domain Family
PRK14692

?
PRK14692: PRK14692 
flagellar hook-associated protein FlgL
Statistics
?
PSSM-Id: 173155
View PSSM: PRK14692
Aligned: 7 rows
Threshold Bit Score: 1000.63
Threshold Setting Gi: 154175012
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121612548   1 MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDASTYIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKAL 80 
57237716    1 MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDASTYIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKAL 80 
218562507   1 MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDASTYIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKAL 80 
222823826   1 MRISNQYNYYTSIQNYTDGQSLLNKYNLQLQTGQIIQHSFENANIYINGSRLEYELANIGQVIQGTQSAMEMAKNTDTAI 80 
157415144   1 MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDASTYIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKAL 80 
153951331   1 MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDASTYIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKAL 80 
154175012   1 MRITNQLRFSQTLHDYQNSMAGVNKSYRQMSSGLKIQNPYENASVYNDAMRLDYEAETLSQVVEATSKSVNFSKNTDKSL 80 
121612548  81 QDMVKLLEDFKVKVTQAASDSNSQTSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINV 160
57237716   81 QDMVKLLEDFKVKVTQAASDSNSQTSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINV 160
218562507  81 QDMVKLLEDFKVKVTQAASDSNSQTSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINV 160
222823826  81 KNITELLEKFKTLLTKAASDGNSQTSREAIAKELKLIKDSIVNIANTSINGQYLFAGSNTATKPFDKFGNYTGNKDNIFV 160
157415144  81 QDMVKLLEDFKVKVTQAASDSNSQTSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINV 160
153951331  81 QDMVKLLEDFKVKVTQAASDSNSQTSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINV 160
154175012  81 QEFEKQLENFKTKVVQAASDVHSKTSLEALANELQGIKNHLVNIANTSINGQFLFSGSAVDTKPIDGNGKYQGNRDYMKT 160
121612548 161 VTGAGTESPYNIPGWDLFFKADGDYKKQISTNVSFTDN-RWDLTQNPDKTKYLTGDSKWQQLIGQGYVKD---------- 229
57237716  161 VTGAGTESPYNIPGWDLFFKADGDYKKQISTNVSFTDN-RWDLNKDPDKTKYLTGDSKWQQLIGQGYVKD---------- 229
218562507 161 VTGAGTESPYNIPGWDLFFKADGDYKKQISTNVSFTDN-RWDLNKDPDKTKYLTGDSKWQQLIGQSYVKD---------- 229
222823826 161 VSGAGTQIPYNVPGWDLFFKPDTNEHKLISTNVSMIDN-RFDVNKNPDQKKFLDEESKFSYLIGQNYVQG---------- 229
157415144 161 VTGAGTESPYNIPGWDLFFKADGDYKKQISTNVSFTDN-RWDLNKDPDKTKYLTGDSKWQQLIGQGYVKD---------- 229
153951331 161 VTGARTESPYNIPGWDLFFKADGDYKKQISTNVSFTDN-RWDLNKDPDKTKYLTGDSKWKQLIGQGYVKD---------- 229
154175012 161 SAGAQIELPYNIPGHDLFLGKDNDYSKILTTNVSLTDNtKTDVSENP---KYLTAQSKIKNMIGLNYANDsknvdnqgky 237
121612548 230 -NSLDADKDFEYDDSKLDFPPTTLYVQGTKPDGTSFKSAVLVKPEDTLEDVMENIGALYGNTPNNKVVEVSMNDSGQIQI 308
57237716  230 -DKLDPDKDFDNDELKLNFPPTTLYVQGTRPDGTSFKSAVLVKPEDTLEDVMENIGALYGNTPNNKVVEVSMNDSGQIQI 308
218562507 230 -NSLDADKDFEYDDSKLDFPPTTLYVQGTRPDGTSFKSAVLVKPEDTLEDVMENIGALYGNTPNNKVVEVSMNDSGQIQI 308
222823826 230 -GGLDPDKDFDYDT-KLDFPKSSMYIQGVKPDGTSFKATINIGPEDKIGDVLENIGKLYGNTDTNKVVEVSMNDSGQIEI 307
157415144 230 -NGLDPDKDFEYDD-KLDFPPTTLYVQGTKPDGTSFKSAVLVKPEDTLEDVMENIGALYGNTPNNKVVEVSMNDSGQIQI 307
153951331 230 -NGLDPDKDFEYDDSKLDFPPTTLYVQGTKPDGTSFKSAVLVKPDDTLEDVMENIGALYGNTPNNKVVEVSMNDSGQIQI 308
154175012 238 aGSINPDYDF-LDSSNINFPDTYFYMQGKKPDGTSFTSKFKMTAGASVESLMEKIGQEFGNTATTKVVDVSINNDGQFNI 316
121612548 309 TDLKQGNNKLDFHAVAFTPQADDKTELNNIIQA-AQNEGITMEDVTNRVMTAALgNPNNGDITNLNNPVTIQINGQNFEI 387
57237716  309 TDLKQGNNKLDFHAVAFTPQADDKTELNNIIQA-AQNEGITMEDVTNRVMTAALgNPNNGDITKLNNPVTVTINNQQFTI 387
218562507 309 TDLKQGNNKLDFHAVAFTPQADDKTELNNIIQA-AQDEGITMEDVTNRVMTAALgNPNNGDITNLNNPVTIQINGQNFEI 387
222823826 308 KNLKEGNSSLDFHAIALTPQAQNKEQITTLKEA-AEAEGITMDQLTDRIMQAA----HNGNLNNVTSPVTVRVNNQDFQL 382
157415144 308 TDLKQGNNKLDFHAVAFTPQADDRAELTGIIDA-AKQEGISMDEVTNRVMQAATaAPSNGDITKLNSPVTVTINNQQFTI 386
153951331 309 TDLKQGNNKLDFHAVAFTPQFDDKAEYQNIKDAmAANPPMSMDNLTNAVMTAAT-QQNNGDITKLNNPVTVTINNQQFTI 387
154175012 317 KDLTKGNQVIDFHMVAATSTATNKNAIA-----------------------------PNNALDGVNTLADLETMASTNPK 367
121612548 388 DLKQTDFIKSKMTDTDGNAANGADYDNVYFEKNGNTVYGNVSQVIKGSNAYATDSTKLSEVMAGD----------SLNGT 457
57237716  388 DLKQTDFIKSKMTDTDGNATNGADYDNVYFEKNGNTVYGNVSQVIKGNNAYATDSTKLSEVMAGD----------SLNGT 457
218562507 388 DLKQTDFIKSKMTDTDGNAANGADYDNVYFEKNGNTVYGNVSQVIKGSNAYATDSTKLSEVMAGD----------SLNGT 457
222823826 383 NIHQTDFIKSNI---NGNKTNGKEFD-VPFEKDGNTVYGNVSQIIKGTSEYATDSTKLSEVIANAn--------gDMTGQ 450
157415144 387 DLKQTDFIKSKMTDTDGNATNGADYDNVYFEKNGNTVYGNVSQVIKGSNAYATDSTKLSEVMAGD----------SLNGT 456
153951331 388 DLKQTDFIKSNMTDSDGKPANGADYDNVYFEKNGNTVYGNVSQVIKGSNAYATDSTKLSEVMAGD----------SLNGT 457
154175012 368 TVHITEFTKSKFKDKDGNTVNSFDFDRVRFDKKDNKIIGTISQVVRKSGEYATDSTRLSEVAGIDklypkeqgkyNIDDR 447
121612548 458 TLNLKVNSKGGNSYDVTINL-------QTSTVSYPDPNNPGQTISFPIMHT--NPATGNS-GVVTGSNDITYGQINDIIG 527
57237716  458 TLNLKVNSKGGNSYDVTINL-------QTSTVSYPDPNNPGQTISFPIMHT--NPATGNS-GVVTGSNDITYGQINDIIG 527
218562507 458 TLNLKVNSKGGNSYDVTINL-------QTSTVSYPDPNNPGQTISFPIMHT--NPATGNS-GVVTGSNDITYGQINDIIG 527
222823826 451 ELQMSITSKSGQTYNVTIDL-------ENSRVSYPDPNNPGQTISFPITHSqyNEATGTSvGMQTRPEDITYGQLNDIIG 523
157415144 457 TLNLKVNSKGGNSYDVTINL-------QTSTVSYPDPNNPGQTISFPITHT--DPATGNS-GVVTGSNDITYGQINDIIG 526
153951331 458 TLNLKVNSKGGNSYDVTINL-------QTSTVSFKDPKNPNQTISFPITHT--DPATGNS-GVVTGSNDITYKQLNDIIG 527
154175012 448 KLTMEIVSRNGTKYKVDIDLgheeapaQTAKFTISGTTSAGTPIAAQTFDI--WHATEYG-QFKTPTKDVTFRQINDIIS 524
121612548 528 MFAADKIPTTTIQAN-NGQINNADYTQIQQLMKDSQATVDVSMDYKGRISVTDKLSSGTNIEISLSDSQSGQ---FPAPP 603
57237716  528 MFAADKIPTTTIQVN-NGQINNADYTQIQQLMKDSQATVDVSMDYKGRISVTDKLSSGTNIEISLSDSQSGQ---FPAPP 603
218562507 528 MFAADKIPTTTIQAN-NGQINNADYTQIQQLMKDSQATVDVSMDYKGRISVTDKLSSGTNIEISLSDSQSGQ---FPAPP 603
222823826 524 MFASDNVPTATINANqNGTINNNDFQTIQQNIDDSKGFVEVNMDYKGRISITDKFSTNTNIGVSIKDGNSNT-------G 596
157415144 527 MFAADKIPTQSITAT-NGKVDANGYNNLQQLMKDSQATVDVSMDYKGRISVTDKLSSGTNIEISLSDSQSGH---FPQPP 602
153951331 528 MFAADRIPTTTIQAN-NGQINNADYTQIQQLMKDSQATVDVSMDYKGRISVTDKLSSGTNIGISLSDSQSGQ---FPQPP 603
154175012 525 MAASDNIPTA------------NTYDNYNSAISLSKGAVEVNMNEKGKIELTDKTNAVSTIQVAAYDSTTNSdkfYGDST 592
121612548 604 FTTTSTVQ-NGPNFSFSANNSLTIDEPNVDIIKDLDSMIDAVLKGNMRADSESENPRNTGMQGALERLDHLADHVSKLNT 682
57237716  604 FTITSTVQ-NGPNFSFSANNSLTIDEPNVDIIKDLDSMIDAVLKGNMRADSESENPRNTGMQGALERLDHLADHVSKLNT 682
218562507 604 FTTTSTVQ-NGPNFSFSANNSLTIDEPNVDIIKDLDSMIDAVLKGNMRADSESENPRNTGMQGALERLDHLADHVSKLNT 682
222823826 597 FPTVGGQTvQGSNFVFSANNSLTIDDPNVDLIKDLDEMIDAVLNGNMRADSEGKDPRNTGLQGALERIDHLQDHVRKMHT 676
157415144 603 FSTTSSVT-NGPNFSFSANNSLVIDEPNVDIIKDLDSMIDAVLKGNMRADSESEDPRNTGMQGALERLDHLADHISKLNT 681
153951331 604 YTTTAQVQ-NGPNFSFSANNSLVIDEPNVDIIKDLDSMIDAVLKGNMRADGNSADPRNTGMQGALERLDHLADHVSKLNT 682
154175012 593 GTTAATSQgRGSVFSFSENNAITIDEPSVNIFDDLDKMIEAVRQGYYRSNAENGDPRNTGMQGALERLDHLIDHANKELT 672
121612548 683 TMGAYHNTIEGVNTRTSFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM 750
57237716  683 TMGAYHNTIEGVNTRTSFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM 750
218562507 683 TMGAYHNTIEGVNTRTSFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM 750
222823826 677 TIGAYTNNIEETNKRMTFLNVNVASIKSGVTDADYGQTYMQFMQTMVSYQAMLSATSKISQMSLLNYM 744
157415144 682 TMGAYHNTIEDVNTRSTFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM 749
153951331 683 TMGAYHNTIDGVNTRVNFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM 750
154175012 673 KVGSQTKLITSTNERASLMKVNVLTVKNEVIDADYAEAYLNFTQKTLSYQAMLQASAKINQLSLLNYL 740
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap