Conserved Protein Domain Family
PRK14689

?
PRK14689: PRK14689 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173152
View PSSM: PRK14689
Aligned: 8 rows
Threshold Bit Score: 134.856
Threshold Setting Gi: 78212717
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148239704  11 VNAKLTTATTGLWAEAKALRLLQGRGWTLLEKRWSCRYGEIDLLLCKANapvpRLLAVEVKGRRRCGPDGWGLAAFDARK 90 
148242415   1 MLLLAVVMAWGAEAEAQVAVLLCRRHWRLLDCNWCCRWGELDLVLAKPQ----RLLLVEVKARRRWGLDHGGLLACGPRK 76 
124023316   1 ---MMESTRKGCWGEERVLRLLRRRGWQLVSQRWSCRYGELDLVLEKQQ----RLLVVEVKSRRSRGLDLWGLSAFNKGK 73 
113953831   9 HPLLSNSQALGAQAELYVKEVLLRHGWRLLEHNWSCRYGEIDLLFTKQSfpasRILVVEVKARHRSGLDGWGVAAFHQAK 88 
78212717    1 ----MGCQCSGGWAEQQALQQLEAQGWRLLDRNWHCRWGELDLVLERQL----LLLVVEVKGRRMGHHDRHGLDAFHSAK 72 
78184857    1 ---MTKQQIQGDRAEEIAFQLLQRKGWVLLDRNWSCRWGELDLVLQKDQ----RLLVVEVKGRTAQRHDRGGLDAFHSHK 73 
33862897    1 ---MMDSTGMGCWGEERVLRLLQKRGWQLVSQRWSCRYGELDLVVEKQQ----RVLVVEVKSRRSRGLDHWGLCAFNKGK 73 
33865585   14 DRIPMKMQPPGAQAETRVSSLLQRQGWQLLDRNWSCRWGELDLVLHKNE----QLLVVEVKKRRSLA---WGPWSVDPTK 86 
148239704  91 RQRLALTLNYWIALNPRHACCQLEVVLALVplpPNHRPVRWLKVPDLV 138
148242415  77 RCRLARALRCWLAAHPSYAFHSIEAHLALV---DGEGQVRWFPLEHLG 121
124023316  74 QLRLKRAIGCWLATHPYFAEHSLELVLALVplpPSRNTLDWIRIDDLD 121
113953831  89 RRCLARTVECWRAANAWSEASCFEVVLALVvlpVHRHGLRWIPIDVLD 136
78212717   73 RRRMARAISCWRAVHPASAEQLLRVKLALVplnNTPSN------DSLD 114
78184857   74 RRRLARAINCWRSHHPDAGHQLLQVVLALVnlsGSATRVRWLAIHQLS 121
33862897   74 QLRLMRAIGCWLATHPYFAEHSLELVMALVplpPSQNTLDWIRIDDLD 121
33865585   87 RRRLGRAISCWRAEHPIQTDWLLQVAVAVVplpPSQGAPRWCRLDRLC 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap