Conserved Protein Domain Family
PRK14685

?
PRK14685: PRK14685 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173148
View PSSM: PRK14685
Aligned: 2 rows
Threshold Bit Score: 267.033
Threshold Setting Gi: 33598544
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603489   1 MTDTATRLAFARAAQAQRRLHRRPPASPRARPGARDGGSPTQRRGQAYESAALRWLARQGLRPLARNLRCRAGEIDLAMR 80 
33598544   1 MTDTATRLAFARAAQAQRRLHRRPPASPRASPGARDGGSPTQRCGQAYESAALRWLARQGLRPLARNLRCRAGEIDLAMR 80 
33603489  81 DGEVLVLVEVRVRAHAGYGGAAASIGASKQGRLARAAALLLPVLLRRHWPGAPPPVRFDVVAFEAGRPHWLRGAFWLAEH 160
33598544  81 DGEVLVLVEVRARAHAGYGGAAASIGASKQGRLARAAALLLPVLLRRHWPGAPPPVRFDVVAFEAGRPHWLRGAFWLAEH 160
33603489 161 APAQGRRGQDAQGWRVR 177
33598544 161 APAQGRRGQDAQGWRVR 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap