Conserved Protein Domain Family
PRK14684

?
PRK14684: PRK14684 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173147
View PSSM: PRK14684
Aligned: 5 rows
Threshold Bit Score: 177.922
Threshold Setting Gi: 212211783
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154705976   1 MFSLTQKIGFNAEKTACRYLQKQGLSFITKNFRYKQGEIDLIMSDQSMLVFIEVRYRRFSDFIHPVATVTPLKQRRLIKT 80 
29655030    1 MFSLTQKIGFNAEKTACRYLQKQGLSFITKNFRYKQGEIDLIMSDQSMLVFIEVRYRRFSDFIHPVATVTPLKQRRLIKT 80 
161830032   1 MFSLTQKIGFNAEKTACRYLQKQGLSFITKNFRYKQGEIDLIMSDQSMLVFIEVRYRRFSDFIHPVATVTPLKQRRLIKT 80 
212217934   1 MFSLTQKIGFNAEKTACRYLQKQGLSFITKNFRYKQGEIDLIMSDQSILVFIEVRYRRFSDFIHPVATVTPLKQRRLIKT 80 
212211783   1 ------------------------MSFITKNFRYKQGEIDLIMSDQSMLVFIEVRYRRFSDFIHPVATVTPLKQRRLIKT 56 
154705976  81 ALHYLQKHRLLDKISCRFDIVGITADRQITWIKNAIEVEY 120
29655030   81 ALHYLQKHRPLDKISCRFDIVGITADRQITWIKNAIEVEY 120
161830032  81 ALHYLQKHRLLDKISCRFDIVGITADRQITWIKNAIEVEY 120
212217934  81 ELHYLQKHRLLDKISCRFDIVGITADRQITWIKNAIEVEY 120
212211783  57 PLHYLQKHRLLDKISCRFDIVGITADRQITWIKNAIEVEY 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap