Conserved Protein Domain Family
PRK14683

?
PRK14683: PRK14683 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173146
View PSSM: PRK14683
Aligned: 5 rows
Threshold Bit Score: 204.734
Threshold Setting Gi: 73666690
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58616781   1 MPYKKDYKRLAYNTLGYLGEVLIILFLKCKLYHIIKHRYRCPLGEIDIIAHKNKQLVFIEVKTSLFNKNIPITYKQQKSI 80 
58578720   1 MPYKKNYKRSAYNTLGYLGEVLIILFLKCKLYHIIKHRYRCPLGEIDIIAHKNKQLVFVEVKTSLFNKNIPITYKQQKSI 80 
57238794   1 MPYKKNYKRSAYNTLGYLGEVLIILFLKCKLYHIIKHRYRCPLGEIDIIAHKNKQLVFVEVKTSLFNKNIPITYKQQKSI 80 
88658038   1 MFTKKNYKRVIYNIVGYLGEILIIWFLKCKGYYIIKHRYKCILGEIDIIACKNKYLAFIEVKTSIFGSEIPITNKQQRSI 80 
73666690   1 MQIKKNYLKVTYNMIGYLGEVIIIWILKCKRYHIIKHRYKCTLGEVDIIAFKNQTLVFIEVKTSILRSEIPITYKQQQSI 80 
58616781  81 LKSAKYFIAFHRKFANYSIRFDLYFFSLSTGLTHIPNAWQEP 122
58578720  81 LKSAKYFIAFHRKFANYSIRFDLYFFSLSTGLIHIPNAWQES 122
57238794  81 LKSAKYFIAFHRKFANYSIRFDLYFFSLSTGLIHIPNAWQES 122
88658038  81 IKAAKSFITYHTKFEEYNIRFDLYFFSLSKGLIHIPHAWQEF 122
73666690  81 IRVAKHFITYYTKFEKYNIRFDLYFLSLSKGLIHITNAWQET 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap