Conserved Protein Domain Family
PRK14682

?
PRK14682: PRK14682 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173145
View PSSM: PRK14682
Aligned: 6 rows
Threshold Bit Score: 211.835
Threshold Setting Gi: 167626633
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187931299   1 MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALDKDTLVFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSA 80 
167626633   1 MKTIEIGNKAEEQASKFLRTKNLQILAQNFKAFPYGEIDIIALDQNTLVFIEVKYRSKTKFAKAEEMLTYSKQQKLINAA 80 
118497031   1 MQTIEIGNKAELQACKFLHTQELEILAHNFKALPYGEIDIIALDKDTLVFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSA 80 
134302211   1 MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALDKDTLVFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSA 80 
110670470   1 MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALDKDTLIFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSA 80 
56707999    1 MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALDKDTLIFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSA 80 
187931299  81 SIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI 117
167626633  81 NIFLQENPKFENYECRFDLIAINKEDINWIKNAFILN 117
118497031  81 SIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI 117
134302211  81 SIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI 117
110670470  81 SIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI 117
56707999   81 SIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap