Conserved Protein Domain Family
PRK14680

?
PRK14680: PRK14680 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173143
View PSSM: PRK14680
Aligned: 5 rows
Threshold Bit Score: 205.836
Threshold Setting Gi: 120603191
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
220905055  27 PAAAHLRLGSAGEDAAAELLTGAGCTLLARNWRQARLELDMVCLDGDTIVFVEVKTRSSERYGGPAYAVGLSKQRVLCRA 106
218887965  13 SATGNAAIGARGEEAAARLLAQRGLRVLARNWRHGGLELDIVCDDRGTLVFVEVKTRAASGPARPDEALTTAKRGKLVRA 92 
120603191   1 MVDARHATGQHGEDEAAALLQRTGHRIIARNWRHGGLELDIICETGDTIVFVEVKTRAAHGLTSPTDALTHQKRHRLIRA 80 
94986667    1 --MKSCEIGQQGESAAALFLYNKGMSILERNWRKGRFEIDLVCQDIKTLVFVEVRTRKAKGMLLPEQTLTISKRCNIIHS 78 
46579246    1 MVDARHATGQHGEDEAAALLQRTGHRIIARNWRHGGLELDIICETGDTIVFVEVKTRAAHGLTSPTDALTHQKRHRLIRA 80 
220905055 107 ARAWLAAHEAWDKPCRFDVICVLRNGDTLHLEHFRHAFDCPPALDSSHTSWQPW 160
218887965  93 ARQYLAAHDCWDKPCRFDLVCVVHDGATLTLEHYPHAFDLTASLGGGDAAWQPW 146
120603191  81 ARAWLAAADAWDRACRFDLVCVTQRGATCTLEHITDAFDLTETLGGGDTSWQPW 134
94986667   79 AQLYLMDKKDWSMPCRFDVICIISKKTTLELEHYKNVFEFYEIMDSSNTSWQPW 132
46579246   81 ARAWLAAADAWDRACRFDLVCVTQRGATCTLEHITDAFDLTETLGGGDTSWQPW 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap