Conserved Protein Domain Family
PRK14679

?
PRK14679: PRK14679 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173142
View PSSM: PRK14679
Aligned: 8 rows
Threshold Bit Score: 137.727
Threshold Setting Gi: 188579742
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
220920077   2 TRTDDPAARRRRATYLRGHGAERLALLALLLKGYRPLARRFAAAGGEIDLVMRRGSVIAFVEVKARPTLDAAAAAIDARK 81 
218528487   1 MRPPADPGARRRATHGRGLSAEGLALLVLMLKGYRPLARRFAAAGGEIDLIVRRGRTIAFVEVKARATLDAAATAIDARK 80 
163849856   1 MRPPADPGARRRATHGRGLSAEGLALLVLMLKGYRPLARRFAAAGGEIDLIVRRGRTIAFVEVKARATLDAAATAIDARK 80 
188579742   1 MRPPPDPQARRRATHGRGLSAEALALLALMLKGYRPLARRFAASGGEIDLIVRRGRTIAFVEVKARATLEAAAIAIDGRK 80 
170738388   6 AGPARRAAQRRRATYLRGHGAERLALLALLVKGYRPLARRYSAAGGEIDLVVRRGAVVAFVEVKARPTLDEAAAAIDARK 85 
170749345   2 TGALPDGADRRRAAYRFGHRAEWLALAALMLKGYWPIGRRVSVAGGEIDLVVRRWNTVVFVEVKARAKRDDAREAIDGAK 81 
240137082   1 MRPPADPEARRRATHGRGLSAEGLALLALMLKGYRPLARRFAAAGGEIDLIVRRGRTIAFVEVKARATLDAAATAIDARK 80 
254559092   1 MRPPADPGARRRATHGRGLSAEGLALLVLMLKGYRPLARRFAAAGGEIDLIVRRGRTIAFVEVKARATLDAAATAIDARK 80 
220920077  82 RRAFSRAARAWIARHPWSAGLTLRADAVFVAPRRWPRHLVSAFDLEPS 129
218528487  81 RARVSRAARAWLARHPLAADTTLRADAVFVAPRRWPRHLPNAFEIEGL 128
163849856  81 RARVSRAARAWLARHPLAAGATLRADAVFVAPRRWPRHLPNAFEIEGL 128
188579742  81 RARMSRAARAWLARHRLPADAILRADAVFVAPRRWPLHLPNAFEI--- 125
170738388  86 RRAFSRAARAWMARNPWSAGLTLRADAVFVAPRRWPRHLVSAFALEMS 133
170749345  82 RRRFSRAVRAWIGRNAWCAGATFRADAVFVGHWAWPAHVERVFTIEGL 129
240137082  81 RARVSRAARAWLARHPLAADATLRADAVFVAPRRWPRHLPNAFEIEGL 128
254559092  81 RARVSRAARAWLARHPLAAGATLRADAVFVAPRRWPRHLPNAFEIEGL 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap